Vi använder cookies för att erbjuda en bättre upplevelse, samla in statistik och visa relevanta annonser. Genom att använda vår tjänst godkänner du detta. Läs mer i vår cookiepolicy.

Gräsklippare: 16 modeller i test

Av PriceRunner Uppdaterad 2018-10-31

Söker du efter en prisvärd gräsklippare? Vi har testat alla de hetaste gräsklipparna på marknaden och i vårt test blir AL-KO Silver 524 SP-A Premium bäst i test. Den briljerar med smarta lösningar och enorm prestanda.

Stihl MA 443 C blir bästa batterigräsklippare eftersom den också är enormt stark och innovativ.

Bästa budgetval är AL-KO Silver 460 BR-A Bio. Det är en lite enklare gräsklippare som orkar med betydligt mer än vad man kan tro vid första anblick.

Så gjorde vi testet

Alla modeller har långtidstestats under minst en sommar. Vi bedömde klippresultatet dels direkt efter klippning, dels efter en tids regelbundet klippande. Alla gräsklippare testades på flera olika gräsmattor med flera olika grästyper och höjder på gräset. Vi klippte även gräset i olika grader av väta.

  • Prestanda
    Vi beräknade klipphastighet, bränsleförbrukning, klippkostnad och klippkapacitet genom att klippa ett antal stora, plana gräsmattor vars areor och gräshöjder vi uppmätt.

  • Användarupplevelse
    Även bullernivåer och styrvibrationer uppmättes. Dessutom noterade vi förekomsten och intensiteten av eventuella bränsleångor.

Under testresultaten har vi gjort en komplett sammanställning över alla de egenskaper vi bedömde i vårt test av gräsklippare. Varje egenskap förklaras där i detalj och sammanställningen bildar därigenom en praktisk guide som kan läsas inför köp av gräsklippare, oavsett typ och modell. gräsklippare på Pricerunner här.

Bäst i test

AL-KO Silver 524 SP-A Premium

Högpresterande allroundklippare till ett bra pris
Kraftfull motorrobustgoda terrängegenskaperframdriftvadderade handtagsmidig klipphöjdsjustering
Mycket hög ljudnivålite plastig uppsamlareganska klumpig på små och komplicerade ytor

Silver 524 SP-A Premium från tyska AL-KO utnämns till bäst i test tack vare sin kombination av prestanda, komfort och funktionalitet till ett överkomligt pris. Gräsklipparen är robust konstruerad med en stark motor, vilket också känns när man framför den. Den klipper effektivt högt och grovt gräs utan att behöva krypa då motorn klarar hög belastning. Därigenom hålls bensinångorna till ett minimum.

Föga förvånande innebär kraftmotorn tyvärr en bullernivå klart över medel.

Den är ergonomisk

Handtagen är vadderade och detta ger ett skönt handgrepp samt minskar styrvibrationerna, men även risken att klämma sig på byglarna. Klipphöjden justeras smidigt centralt och har många olika nivåer.

Bakhjulsdriften i kombination med de stora bakhjulen ger en god framkomlighet och ökar möjligheterna att använda framdriften. Uppsamlaren är lite plastig men vi gillar skarpt att den ingår utan extra kostnad.

Likt andra bensingräsklippare gör även denna sig bäst på okomplicerade och lite större gräsmattor, då den lätt upplevs ganska klumpig i små trädgårdar med mycket vändande och många kantytor såsom träd, buskar och murar.

Prisklass: Premium Kraftkälla: Bensin Motoreffekt: 2300 W (vid 2800 rpm) Tankvolym: 1,2 L Klipphöjd: 30-80 mm (7 steg) Klippbredd: 51 cm Motor: Pro 160 Quick Start Vikt: 38,5 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 82 dB Styrvibrationer: Måttliga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: 70 L

Bästa batterigräsklippare

Stihl MA 443 C

Fenomenal batteriklippare med användarvänliga funktioner
Användarvänlig designenkel klipphöjdsjusteringhög prestanda
Viss risk att klämma sig på gashandtaget

Stihl MA 443 C blir med sin kombination av god klippkapacitet och genomtänkt design, till ett bra pris, bästa batteriklippare. Den är lätt att stuva undan då den kan fällas ihop så att den bara blir cirka 40-50 centimeter hög. Likaså justeras klipphöjden busenkelt genom att med ett enhandsgrepp trycka in ett handtag och dra gräsklipparens kropp upp eller ned.

MA 443 C passar både långa och korta personer eftersom du även kan justera höjden på handtaget.

Så lätt att styra

Själva handtaget är av hårdplast, och säkerhetsspärren är infälld i plasten, vilket gör att du får ett skönt grepp när du är ute och klipper. Den är lätt att styra, mycket på grund av att den väger relativt lite.

MA 443 C har också låga styrvibrationer och hanterar kuperad terräng utmärkt. Kåpan av högkvalitativ hårdplast klarar både sly och vanligt gräs utan att påverkas märkbart.

Klipper en stor yta

Klippbredden kan anses vara medelstor. Nu är detta fortfarande en batterigräsklippare, och med dessa följer en lite smalare klippbredd. Den stora fördelen med batterigräsklippare är deras effektivitet på mindre och mer slingriga ytor. Medan bensingräsklipparna med sin väl tilltagana klippbredd gör sig bra på stora, öppna ytor.

Stihl MA 443 C är speciell på så vis att den saknar en nedre horisontell stång som brukar sitta på de flesta gräsklipparna. Vi uppskattar detta då det ger bättre sikt i gräsklipparens omedelbara område. Ska du till exempel runda en buske ser du direkt om du närmar dig en sten eller annat hinder. Du får också bättre översikt över själva gräsklipparen.

Den klarar att klippa angivna 1 000 kvadratmeter - även när det är någorlunda högt och grovt gräs. Den klarar också mycket grovt gräs även om det förstås påverkar batteritiden en del, dock mindre än genomsnittet. Drifttiden förblir således god vid tufft motstånd. Dessutom är MA 443 C utrustad med dubbla batterifack, så när det ena batteriet är slut är det bara att byta plats på dem och du kan klippa ytterligare 1 000 kvadratmeter.

Ett mycket bra köp

Sammantaget är detta en riktig kraftmaskin som samtidigt har god drifttid och smarta, användarvänliga lösningar. Det är ett mycket bra köp för den som har en medelstor gräsmatta med svårigheter såsom kuperad terräng och många hinder på gräsmattan. Den levererar batterigräsklipparens alla fördelar utan att kompromissa med prestanda eller framkomlighet.

Kraftkälla: Bensin Motoreffekt: 2700 W (vid 2900 rpm) Tankvolym: 1 L Klipphöjd: 25-75 mm (5 steg) Klippbredd: 46 cm Motor: Briggs & Stratton Vikt: 27 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 83 dB Styrvibrationer: Måttliga (3,5 m/s²) Justerbart handtag: Ja Multiclip: Nej (kan köpas som tillbehör) Framdrift: 3,5 km/h Uppsamlare: 55 L

Bästa premiumval

Viking MB 448 TC

Smidig bensingräsklippare för komplicerade gräsmattor
Hög byggkvalitetrelativt låg vikthög komfortgoda terrängegenskaper
Viss risk att klämma sig på gashandtaget

Viking MB 448 TC är en innovativ och lättmanövrerbar premiumgräsklippare och utnämns till bästa premiumval.

För att vara en bensindriven gräsklippare så har MB 448 TC en låg maskinvikt och tillsammans med framåtdriften gör det att gräsklipparen inte kräver så stor ansträngning att manövrera. Den låga maskinvikten har delvis åstadkommits genom att använda ett chassi av högkvalitativ hårdplast istället för stål. Viking lämnar 10 års garanti på plastchassit, så kvaliteten lär vara mycket hög, men som alla gräsklippare bör MB 448 TC inte förvaras i direkt solljus.

Även en klippbredd under snittet bidrar till en lägre vikt. Gräsklipparens nätthet gör det enklare att kantklippa runt buskar, träd och trädgårdsmöbler. Tillsammans med bakhjulsdriften bidrar den även till en god framkomlighet i kuperad terräng. Dock gör det förstås att det tar lite längre tid att klippa stora ytor.

Enkelt att justera den

Justering av monohandtaget och klipphöjden är båda väldigt enkla, men det finns viss risk att klämma sig på gashandtaget.

Framåtdriften är enkelväxlad, men hastigheten är väl avvägd och gräsklipparen orkar med grovt, halvlångt gräs utan att överbelastas.

Uppsamlaren är mycket smidig att komma åt tack vare monohandtaget och en mängdindikator meddelar när den är full.

MB 448 TC saknar mulching-funktion då det är tänkt att uppsamlaren alltid ska användas och så länge detta görs så ger den ett jämnt och fint klippresultat. MB 448 TC får briljera mest på medelstora till stora gräsmattor med ojämna kanter, kuperad terräng och många hinder.

Kraftkälla: Bensin Motoreffekt: 2700 W (vid 2900 rpm) Tankvolym: 1 L Klipphöjd: 25-75 mm (5 steg) Klippbredd: 46 cm Motor: Briggs & Stratton Vikt: 27 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 83 dB Styrvibrationer: Måttliga (3,5 m/s²) Justerbart handtag: Ja Multiclip: Nej (kan köpas som tillbehör) Framdrift: 3,5 km/h Uppsamlare:** 55 L

Bästa budgetval

AL-KO Silver 460 BR-A Bio

Självgående bensingräsklippare med lågt pris och hög prestanda
Konkurrenskraftigt priskraftfull motorsjälvgåendegoda terrängegenskaper
Manöverbygeln saknar gummihandtag

AL-KO Silver 460 BR-A Bio är en bensingräsklippare som levererar mycket kraft och hög byggkvalitet till ett lågt pris och utnämns därför till bästa budgetval. Gräsklipparen är självgående vilket gör klippningen snabbare och mindre ansträngande.

Karaktäristiskt för prisklassen har framdrivningen emellertid bara en hastighet. Denna är å andra sidan välavvägd med tanke på att motorn ska orka klippa även högre gräs utan att överansträngas och få motorstopp. Vid mycket högt gräs - högre än tio centimeter - gäller det däremot att smyga fram, även om det öppningsbara sidoutkastet kan minska motståndet.

Framdriften regleras via en manöverbygel som tyvärr saknar gummihandtag för att minska klämrisken, något som dessvärre fortfarande är standard i denna prisklass.

Den går bra i terrängen

En måttlig maskinvikt kombinerad med framhjulsdrift och stora hjul ger Silver 460 BR-A goda terrängegenskaper. Klipphöjden justeras smidigt med en spak vilket sparar både tid och skonar ryggen.

AL-KO Silver 460 BR-A Bio är en mycket bra gräsklippare för den som vill ha en billig gräsklippare med hög prestanda.

AL-KO Classic 5.16 VS-B Plus 625 Series E

Många funktioner i stark gräsklippare
Enkel klipphöjdjusteringsmidig hastighetsjusteringfunktionsrik
Ej anpassad för korta personerlite obekväm handtagslösning

AL-KO Classic 5.16 VS-B Plus 625 Series E är överlag en mycket kompetent gräsklippare, den känns genomtänkt och användarvänlig.

Klipphöjdjusteringen är exempelvis mycket smidig. Du justerar hela maskinkroppen med en enda spak, istället för att behöva punktjustera vid varje hjul. En annan behändig funktion är den steglösa hastighetsjusteringen. Med hjälp av vad som liknar ett litet gashandtag ställer du enkelt hastigheten. Du kan på så vis exempelvis sänka hastigheten när du ska runt besvärliga hörn och höja den igen på raksträckor.

Själva handtaget på gräsklipparen kunde dock haft bättre ergonomi. Säkerhetsspärren är inte integrerad, så det blir inte ett lika skönt grepp som det kunde ha varit.

En annan ergonomisk anmärkning är höjdjusteringen av handtaget vars två lägen båda är för höga för korta personer. Vi hade även önskat att man slapp skruva ur hela skruven för att genomföra höjdjusteringen.

En ganska användarvänlig gräsklippare

Classic 625 Series E gör ett mycket bra klipparbete. Den lämnar ett fint klippresultat och gör även ett bra arbete om du har lite pinnar, fallfrukt och annat som ligger på gräsmattan.

Gräsklipparen har så kallad 4-i-1-funktion vilket innebär att du kan klippa traditionellt med uppsamlare, men även mala ner gräset genom mulchingfunktionen. Om du inte sätter i pluggen för mulching blir det ett ganska stort glapp baktill. Detta gör att den skjuter ut en del gräsrester och grenar på fötterna när du klipper. Vi rekommenderar därför att du alltid har den i.

När vi använder uppsamlaren märker vi att den är väldigt enkel att hålla ren mellan användningarna tack vare utformning och materialval. Vi ger även plus för att det är så enkelt att backa gräsklipparen. Hade det inte varit för den haltande ergonomin, främst för korta personer, hade betyget blivit högre. Sammantaget är dock detta en riktigt bra gräsklippare.

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 2300 W Klipphöjd: 30-80 mm (central, 6 steg) Klippbredd: 51 cm Motor: B&S Series 625 E Vikt: 33,4 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 87 dB Styrvibrationer: Måttliga Självgående: Ja Justerbart handtag:Ja Multiclip: Ja Uppsamlare: 65 L

Ryobi RLM36X46H5P

Funktionsrik och lätt till rimligt pris
Både mulching & uppsamlaregod klippkapacitetseparat drivninglättförvaradenkel klipphöjdjustering

Ryobi RLM36X46H5P är en batterigräsklippare med plastchassi som trots sin låga maskinvikt kommer med drivning. Drivningen är dessutom separat vilket innebär att du inte behöver ha klippaggregatet igång samtidigt. Därmed kan du enklare förflytta klipparen in i förråd och liknande utan svårigheter.

Därtill underlättas förvaringen av att klipparen är enkel att vika ihop och då blir väldigt platt. Det finns ett stort handtag på chassit så att du lätt kan lyfta upp RLM36X46H5P på ett hyllplan.

Lite halvdan byggkvalitet

Drivningen kommer väl till pass om du har tomt med slänt. På plan yta är gräsklipparen så pass lätt att du skulle ha klarat dig utan, men det gör förstås inget att drivningen finns där. Vi har lite problem med att den hoppar ur drivningen ibland. Dessutom driver den bara på ett hjul vilket inte känns helt driftsäkert.

Prestandamässigt hinner klipparen med att klippa gräsmattan under normalförhållanden. Men har det vuxit på sig ordentligt går den lite för snabbt för att hinna med, speciellt vid mulching.

För att vara en 36-voltsmaskin har RLM36X46H5P bra driv i motorn och hanterar därför blött och lite högre gräs med bravur. Batteriet kan delas med andra 36-voltsmaskiner från Ryobi och sparar dig i så fall mycket pengar. Vi gillar också att det följer med såväl uppsamlare som mulchingplugg.

Ryobi RLM36X46H5P har en något haltande byggkvalitet och utöver problemen med drivningen som ibland hoppar ur så är maskinen uppsamlaren lite klurig att få på plats.

Vidare så fastnar det en hel del gräs på hjulen. De har en mer gummiaktig yta än många konkurrenters hjul vilket eventuellt bidrar till den här effekten. I övrigt fungerar allt som det ska och det genomskinliga plastchassit ger bra överblick över batteriet.

Har hög användarvänlighet

Gräsklipparen har ett ställbart handtag vilket är positivt eftersom den då kan anpassas till personer av olika längd. Det är också lätt att sänka eller höja klipphöjden. Justeringsanordningen för detta är väldigt tydlig med hack så du kan inte missa vilken inställning du har, och den styrs med en spak vilket är smidigt.

RLM36X46H5P passar dig med en medelstor trädgård, helst med viss lutning för då kommer den till sin rätt. Den är också lättförvarad mellan klippvarven. Dels för att du kan köra den utan drivning, dels för att den blir så liten - sett till sin storlek - och behändig ihopvikt.

Prisklass: Premium Kraftkälla: Batteri Batteri: Typ: Lithiumjon Kapacitet: 5 Ah/36 V Batteritid: 12 min/Ah (uppmätt) Laddindikator: Ja Klipphöjd: 20-70 mm (5 steg) Klippbredd: 46 cm Vikt: 19,9 kg Ljudnivå: Låg | Uppmätt medelvärde: 59 dB Styrvibrationer: Låga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Ja (55 l)

Bosch Rotak 43 Li

Storsäljande batterigräsklippare med imponerande prestanda
Relativt stor klippbreddkraftfulllätt & smidiglåg ljudnivåinga avgaserextrabatteri inkluderat
Smal klippbredd för stora gräsmattor

Batteridrivna gräsklippare är hetare än någonsin och Bosch Rotak 43 Li är mer än någon annan den modell som ligger bakom framgången. Klippbredden är mycket bred för en elgräsklippare men det som vi imponerades mest av är den kraftfulla motorn. Rotak 43 Li höjer nämligen ribban för vad man kan förvänta sig av en batterigräsklippare då den äter sig igenom allt man kan begära och mer därtill. Förutom blött, grovt och långt gräs även storvuxna ogräs som kirskål och hundkäx.

Samtidigt är både ljudnivå och maskinvikt låg och gräsklipparen bärs lätt av samtliga vuxna i familjen. Detta bidrar till att Rotak 43 Li är riktigt behändig vid kanter och under buskar, men gör även självdrift överflödig.

Dessutom är styrramen hopfällbar vilket gör vinterförvaringen smidigare.

Den orkar gå länge

Då Bosch skickar med två stycken batterier och en snabbladdare nästan tredubblas i praktiken drifttiden jämfört med ett batteri. Detta gör Rotak 43 Li till en utmärkt gräsklippare för små och medelstora gräsmattor.

Har man däremot en stor gräsmatta med öppna ytor passar förmodligen en gräsklippare med större klippbredd och kraftigare batteri bättre. Alternativt en bensingräsklippare vid mycket stora ytor. Har du dessutom slänt bör du välja en med drivning, vilket Rotak 43 Li saknar.

Ett riktigt kraftpaket

Förutsatt att du har en lämplig tomt för Rotak lämnar den dock ett mycket fint klippresultat, ett av de finaste vi sett. Den samlar också upp bra, har sköna och lite fräcka rallyhandtag, tydlig höjdinställning och en smidig storlek. Rotak 43 Li utgör ett riktigt kraftpaket och är en av de bästa elgräsklipparna på marknaden för mindre gräsmattor.

Prisklass: Premium Driftkälla: Batteri Batterityp: Lithiumjon Kapacitet: Uppmätt batteritid: 11 min/Ah Laddtid: ca 60 min (80 % laddat efter ca 30 min) Laddindikator: Ja Klippkapacitet: 600 m² Klipphöjd: 20-70 mm (10 steg) Klippbredd: 43 cm Motor: El Vikt: 14 kg Ljudnivå: Mycket låg | Uppmätt medelvärde: 58,7 dB Styrvibrationer: Under medel Självgående: Nej Justerbart handtag: Ja Multiclip: Ja Uppsamlare:50 L

Husqvarna LC 353VI

Förträfflig byggkvalitetkraftfull motorhög komfortgoda terrängegenskaper
Uppsamlaren sänker klippkapaciteten

Husqvarna LC 353VI är en premium-gräsklippare som presterar bäst på större, relativt öppna ytor. Den drivs av en kraftfull Briggs & Stratton-motor som med lätthet äter sig igenom riktigt högt gräs.

LC 353VI har flera unika och praktiska funktioner. Batteristarten gör att man bara behöver trycka ner manöverbygeln för att starta klipparen. Handtaget har ett riktigt skönt grepp och kan enkelt justeras mellan två höjdlägen för bättre ergonomi.

Man kan även enkelt variera hjulens varvtal för att justera hastigheten på framdriften. Detta gör att man kan krypa vid rabatter och köra fort på öppna ytor.

Klipphöjden justeras smidigt centralt.

En intressant konstruktion

LC 353VI har en unikt designad uppsamlare med ett rör som går ut på höger sida. Denna samlar mycket effektivt upp klippt gräs och signalerar tydligt när den fyllts genom att blåsa. Detta ger ett mycket bra klippresultat och lämnar gräsmattan ren från gräsklipp.

Nackdelen med designen är att röret sticker ut från klipparen och därför kan komma i vägen när man klipper mycket nära kantobjekt, såsom träd och murar. Man får i dessa lägen därför se till att man kommer in från rätt håll så att kanten befinner sig till vänster om gräsklipparen.

LC 353VI är designad för att alltid användas med uppsamlare och har därför inte multiclip. Då detta är en stor klippare blir den lätt klumpig på små och trånga ytor.

Kraftkälla: Bensin Motoreffekt: 2700 W (vid 2900 rpm) Tankvolym:1 L Klipphöjd: 25-75 mm (5 steg) Klippbredd: 53 cm Motor: Briggs & Stratton Vikt: 42 kg Ljudnivå: 82 dB (uppmätt maxvärde) Styrvibrationer: 5,3 m/s² Självgående: Ja Justerbart handtag: Ja Multiclip: Nej Uppsamlare: 60 L

Honda HRX 476 VY

Förträfflig byggkvalitet kraftfull motorhög komfortgoda terrängegenskaper
Uppsamlaren sänker klippkapaciteten

Premiummodellen HRX 476 VY från japanska Honda är en gediget byggd arbetshäst med mycket stark motor. Priset för detta är en hög maskinvikt som gör det relativt tungt att parera och backa med den.

Den kraftfulla motorn ger samtidigt ett utmärkt driv och så länge man kan använda framåtdriften så är framkomligheten föredömlig.

Bakhjulsdrift och reglerbar hastighet gör att HRX 476 hanterar kuperad terräng, ojämnt underlag och kraftig lutning med galans. Komforten är hög och såväl klipphöjd som handtagshöjd är enkla att justera. Dessutom kan man stänga av klippaggregatet utan att stänga av motorn.

En begränsande uppsamlare

Tyguppsamlaren är hopfällbar vilket gör den smidigare att förvara. Samtidigt är den bökig att rengöra och luftgenomsläppet kunde varit bättre. Detta försämrar utmatningen vilket i sig leder till att gräsklipparen inte klipper lika bra som när uppsamlaren är av.

Klipper man däremot utan uppsamlare klarar den riktigt tufft motstånd, såsom grovt, högt och blött gräs.

HRX 476 gör sig sammantaget bäst på stora, lite vildare gräsmattor där gräset hinner växa sig högt mellan klippningarna.

Prisklass: Premium Kraftkälla: Bensin Motoreffekt: 2700 W (vid 2800 rpm) Klipphöjd: 25-79 mm (7 steg) Klippbredd: 47 cm Motor: GCV160 Vikt: 42 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 82 dB Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Garanti: 5 år Uppsamlare: 69 L

Klippo Champion

Pålitlig trotjänare som klipper år efter år med minimalt underhåll
Mycket god hållbarhetbra klippbredd
Hög bullernivårelativt starka styrvibrationer

Klippos gräsklippare är kända för sin hållbarhet och vår Klippo Champion har nu faktiskt klarat 7 säsonger utan att behöva repareras. Champion har Klippos distinkt röda färg och ger ett robust intryck.

Motorn är tillförlitlig och presterar väl under normala klippförhållanden. Är gräset däremot blött eller uppåt 10 cm högt får gräsklipparen kämpa ordentligt och motorstopp inträffar lätt om man inte går fram mycket försiktigt över gräsmattan. Så länge gräset inte är för långt gör dock den goda klippbredden att gräsklippningen går ganska fort.

Den långlivade trotjänaren

Flexibiliteten gällande klipphöjd är fullgod med flera möjliga höjdlägen som är lätta att skifta emellan. Styrvibrationerna är ganska starka och bullernivån ligger över genomsnittet, även för en bensingräsklippare. Då man alltid ska bära hörselskydd under klippning med en bensingräsklippare är detta emellertid av mindre betydelse.

För den som främst är ute efter en långlivad trotjänare som presterar år efter år är Klippo Champion ett intressant alternativ.

Prisklass: Premium Kraftkälla: Bensin Motoreffekt: 2700 W (vid 2900 rpm) Klipphöjd: 30-60 Klippbredd: 48 cm Motor: Briggs & Stratton 625e Vikt: 29 kg Ljudnivå: Hög | Uppmätt medelvärde: 77 dB Styrvibrationer: Styrvibrationer Självgående: Nej Justerbart handtag:Ja Multiclip: Ja Uppsamlare: Nej

Stiga Turbo 48 S B

Påkostad premium-modell med hög komfort och prestanda
Mycket kraftfull motorklipper snabbtmodern design
Klumpig på små ytorrelativt saftig prislapp

Stiga Turbo 48 S B är en påkostad premium-gräsklippare med hög prestanda och funktionalitet samt en tilltalande modern design. Den kraftfulla motorn är tillverkad av Briggs & Stratton, som för gräsklipparmotorer är vad Rolls Royce är för flygplansmotorer. Klipparen äter sig därför bekymmersfritt igenom såväl högt som grovt gräs, även under självgående.

Turbo 48 S B utmärker sig också genom sin höga komfort som kommer till uttryck i både stort och smått. Med tanke på motorns höga prestanda är maskinvikten måttlig. Tillsammans med exempelvis bakhjulsdriften gör detta gräsklipparen relativt lätt att manövrera, så länge gräsmattan inte är alltför liten eller slingrig.

Lyxig så det skriker om det

Styret är höj- och sänkbart och har - liksom manöverbygeln - gummihandtag, vilket ger ett skönt grepp samt minskar klämrisken. Startsnöret har ett redigt handtag som ger ett utmärkt grepp vid start, vilket kanske bidrar till att Turbo 48 S B känns lättstartad.

Chassit har ett hål i vilket man kan koppla en vanlig vattenslang för smidig rengöring av kåpan.

Uppsamlaren är av högkvalitativ textiltyp som går att fälla ihop och en markör visar när den börjar bli full. Vi har hittills inte lyckats identifiera några egentliga brister hos Turbo 48 S B och trots sin relativt saftiga prislapp är den riktigt prisvärd. Vill man inte betala extra för lyx finns det emellertid andra modeller som ger ännu mer gräsklippare för pengarna.

Prisklass: Premium Kraftkälla: Bensin Motoreffekt: 2500 W (vid 2800 rpm) Tankvolym: 1 L Klipphöjd: 25-90 mm (6 steg) Klippbredd: 46 cm Motor: Briggs & Stratton 675 EX Vikt: 36 kg Ljudnivå: Hög | Uppmätt medelvärde: 75 dB Styrvibrationer: 6,9 m/s² Självgående: Ja (3,6 km/h) Multiclip: Ja Uppsamlare: 70 L

MTD OPTIMA 46 SPB HW

Nätt storleklätt att manövreraenkel rengöring
Slirar i högt gräsmycket vibrationer

MTD Optima 46 SPB HW är en pigg, självgående bensingräsklippare med stora bakhjul och bakhjulsdrift, en kombination som gör att den rör sig smidigt även över kuperad tomt. Den är även enkel att manövrera runt hinder.

Trots bra mönster på hjulen tenderar den dock att slira lite vid medelhögt, tjockt gräs. Den har också problem att få gräsmattan perfekt klippt på raksträckor då den tenderar att missa en del grässtrån som lägger sig ner när den far fram. Gräsklipparen håller dock en lagom gånghastighet.

Har flera funktioner

På det stora hela får klippresultatet godkänt, speciellt sett till hur bra den maler ner nedblåsta kvistar och grenar som kommer i dess väg.

Optima 46 SPB HW har 3-i-1-funktion vilket innebär att den kommer med både uppsamlare, mulchingfunktion och sidoutkast. Du kan med andra ord välja att antingen samla upp gräsklippet, skicka ut det på gräsmattan eller finklippa och finfördela det över gräsmattan.

Gällande ergonomi och byggkvalitet är det lite dåligt grepp på drivningen. Däremot tycker vi om munstycket på chassit som kan kopplas till trädgårdsslangen, då detta förenklar rengöring av aggregatet.

Vibrerar tyvärr en del

Gräsklipparen dras tyvärr med rätt kraftiga maskinvibrationer. Vi får känningar i handlederna redan efter cirka 500 kvadratmeter klippt yta. Vid ett tillfälle vibrerar sig tanklocket till och med löst.

På plussidan noteras dock att gräsklipparen är smidig och lätt, åtminstone för en bensingräsklippare. Vi blir imponerade över dess styrka med tanke på hur nätt den är.

Optima 46 SPB HW är också riktigt enkel att justera klipphöjden på tack vare den centrala höjdjusteringen.

Sammantaget är den här gräsklipparen ett bra och prisvärt köp för en genomsnittlig villatomt med en del hinder på. Det känns som att MTD har sparat in smart för att få ner priset, du får mycket kraft och en lättmanövrerad gräsklippare men dock med något försvagad ergonomi.

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 1900 W (vid 2800 rpm) Klipphöjd: 28-92 mm (6 steg) Klippbredd: 46 cm Motor: Briggs & Stratton Vikt: 33 kg Ljudnivå: Hög (ca 78 dB*1) Styrvibrationer: Kraftiga Hastighet: 0-3,6 km/h Justerbart handtag: Ja Multiclip: Ja Uppsamlare: 60 l Bruksanvisning: PDF Videoklipp: Demo

Electrolux Flymo Turbo 400

Innovativ el-gräsklippare som imponerar på hinderrika gräsmattor
Lågt pris & viktbillig i driftbra på ojämna & hinderrika gräsmattortar lite plats
Sladdbundenlångsam på långt gräs

Den klassiska luftkuddeklipparen Flymo uppfanns redan på 60-talet av svensken Karl Dahlman, inspirerad av dåtidens nymodighet svävaren. Tekniken bygger på att rotorblad bildar en luftström som skapar en luftkudde under gräsklipparen och får denna att stabilt sväva över marken. Detta ger Flymo en rad unika fördelar vilka troligen är anledningen till att denna annorlunda gräsklippare överlevt tämligen oförändrad i nästan 50 år.

Passar bra i kuperad terräng

Flymo är utmärkt för kuperade gräsytor där vanliga gräsklippare lätt skär sönder gräsmattan. Då den saknar hjul rör Flymo sig med lätthet i alla riktningar, vilket är fantastiskt smidigt i trädgårdar med mycket hinder, såsom växter, stolpar eller kringelkrokiga kanter.

En låg maskinvikt och hopfällbarhet gör den utrymmesbesparande och enkel att hänga upp på väggen.

Se till att klippa i tid

Flymo presterar som bäst när gräset klipps regelbundet och tenderar att likt en helikopter böja grässtråna nedåt när de vuxit sig långa. Samtidigt får den inte motorstopp utan betar sakta men säkert av även högt gräs.

I och med de batteridrivna gräsklipparnas intåg har Flymo nu emellertid fått formidabel konkurrens. En batteridriven gräsklippare är nämligen starkare och betar därmed av längre gräs betydligt snabbare. Dessutom har den batteridrivna gräsklipparen ingen sladd som ständigt måste justeras.

Flymo presterar som bäst på en mindre gräsmatta som klipps ofta och som har ojämnt eller sluttande underlag.

Prisklass: Budget Kraftkälla: Nätel Motoreffekt: 1500 W Klipphöjd: 15-41 Klippbredd: 40 cm Vikt: 7,8 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 83 dB Styrvibrationer: Måttliga (2,72 m/s²) Självgående: Nej Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Nej

AL-KO Gudenaa L45-7

Unik motordriven cylindergräsklippare för skonsammare klippning
Självgående cylinderklippningklarar högt & grovt gräs
Kräver jämnt och fast underlagsjälvdriften kan upplevas väl snabb

Gudenaa L45-7 från tyska AL-KO är något så ovanligt som en motordriven cylinderklippare och motivet är att förena det bästa ur två världar. Handdrivna gräsklippare är av typen cylindergräsklippare och cylinderknivarna gör ett skarpare snitt, vilket är skonsammare mot gräset. Det finns emellertid även en baksida av denna kombination och den stavas viktfördelning.

Även om maskinvikten i sig är normal för en motordriven gräsklippare så framstår Gudenaa i många situationer som tung då all tyngd fördelas på endast två hjul och en kort maskinkropp. Detta gör att gräsklipparen riskerar att köra fast i ojämnheter eller trasa sönder gräs på lös jordmån.

Gör bra ifrån på plant underlag

Givet att underlaget är tillräckligt jämnt och fast så presterar emellertid Gudenaa bra och känslan av att rusa fram över gräset med en självgående cylinderklippare är riktigt berusande.

Vi hade däremot gärna sett fler växlar, speciellt för lägre hastigheter. Räkna därför med att det tar några klippningar att lära sig hantera gräsklipparen på bästa sätt.

Gudenaa saknar multiclip-funktion vilket gör att den lättare äter sig igenom högt och tjockt gräs. Vill man inte ha gräs liggandes på gräsmattan efter klippning bör man dock köpa till uppsamlare.

Prisklass: Premium Kraftkälla: Bensin Motoreffekt: 2300 W Klipphöjd:15-40 mm (7 steg) Klippbredd: 45 cm Motor: Briggs & Stratton Series 550 Vikt: 34 kg Styrvibrationer: Måttliga Självgående: Ja Justerbart handtag:Ja Multiclip: Nej Uppsamlare: Tillval

AL-KO Moweo 46,5 Li

För den som vill hålla enkla ytor i trim
Enkel uppsamlarrengöringlättrullad på raka ytoringa avgaser
Tung i svängarsämre i tuff terrängtrög justering av klipphöjd

AL-KO Moweo 46,5 Li är en lite annorlunda batterigräsklippare. På grund av batteridrivna gräsklippares relativt svaga motoreffekt så har dessa normalt en sparsam klippbredd och plastchassi för att minska belastningen på motorn. Moweo 46,5 Li har däremot en fullt normal klippbredd och ett plåtchassi. I kombination med de stora bakhjulen gör detta att gräsklipparen känns rejäl men också klumpig, speciellt för en batterigräsklippare.

Klumpigheten märks främst när du måste svänga tvärt, exempelvis runt pallkragar, träd och liknande. Det är synd eftersom batterigräsklippare ofta annars gör sig lite extra bra på slingriga små ytor, jämfört med stora öppna där bensingräsklipparna ofta har en fördel. Det är däremot relativt enkelt att klippa rakor och de stora bakdäcken gör den lättrullad.

Den är inte så stark

Så länge gräset inte är särskilt högt gör den ett fullgott klippjobb. Den maler sönder gräset fint och klipper 500 kvadratmeter yta utan problem. Får gräset däremot växa till sig upp emot 10 centimeter så får Moweo 46,5 Li svårare att orka med. Batteriet tar då slut ganska fort. Batteriets status kan du se på den tydliga batteriindikatorn.

Uppsamlingen får godkänt. Torra löv och liknande samlas upp bra, men är det tyngre arbete såsom fuktiga löv måste du sakta ner och gå långsammare för att få med allt. Ett stort plus när det kommer till uppsamlingen är att behållaren är av hårdplast. Det gör att den är stabil i formen och av ett glatt material så den är enkel att spola rent med högtryckstvätten. Den har också ganska rikligt med håligheter och sätter därför inte igen. En nackdel med den är att det krävs tvåhandsgrepp för att lossa den.

Användarvänlighet

Ur ergonomisk och praktisk synvinkel får Moweo 46,5 Li knappt godkänt. Dels måste du justera klipphöjden på tre separata ställen och det krävs dessutom en del kraft eftersom spaken går trögt. Dels kan du inte på något enkelt sätt justera handtagets höjd. Antingen har gräsklipparen därmed rätt höjd för dig, eller så får du använda dig av rallygrepp och placera händerna på sidan när du kör den.

Vi uppskattar höjden som anpassad för personer av medellängd.

Moweo 46,5 Li har låga styrvibrationer och det får den plus för. En fördel med batterigräsklippare är just den att du slipper avgaser och att du får lägre styrvibrationer. Det som främst drar ner betyget är att den är svårstyrd på slingrigare ytor. Moweo 46,5 Li passar därför bäst för dig som har en medelstor och okomplicerad gräsmatta och som sällan ändrar klipphöjd.

Prisklass: Premium Kraftkälla: Batteri Batteri: Typ: Lithiumjon Kapacitet: 4 Ah/36 V Laddtid: 90 min Laddindikator: Ja Klippkapacitet: 500 m² Klipphöjd: 25-75 mm (6 steg) Klippbredd: 46 cm Motor: El Vikt: 30 kg Ljudnivå: 82,7 Styrvibrationer: Låga Självgående: Nej Justerbart handtag: Nej Multiclip: Ja Uppsamlare: 70 L

Toro Recycler 55 AD

Tar mycket i ett svep men krånglig klipphöjdinställning
Lättstartadsmidig mulchingswitchbra rengöringsfunktion
Trög backkrånglig klipphöjdinställning

Toro Recycler 55 AD har en rejält tilltagen klippbredd vilket gör att du kan klippa en större del av gräsmattan på kortare tid än normalt.

Den kommer med både mulching, uppsamlare och sidoutkast, du kan med andra ord finfördela gräset direkt eller samla upp löv med mera. Det gör den här gräsklipparen mångsidig. Dessutom krävs ingen separat plugg för mulchingen, istället styrs detta smidigt med ett reglage. Gräsklipparen har även en säkerhetsfunktion som gör att det inte far ut sten och annat mot dig.

Rätt så ovanliga lösningar

Drivningen på Toro Recycler 55 AD är dock en vattendelare. Istället för den vanliga lösningen med en säkerhetsspärr som fälls in vid handtaget måste du trycka handtaget framåt för att få igång drivningen. På en stor öppen yta är detta mycket behändigt. Men på ytor med många hinder medför det problem. Vanligen lyfter man gräsklipparen lite när man ska runda hinder på gräsmattan eller vända. Gör du det med denna gräsklipparen gasar du eftersom det uppstår en situation där handtaget automatiskt trycks framåt. Den är också väldigt trög att backa. Det gör att komplicerade trädgårdar genast blir betydligt mer svårjobbade än vad de hade varit med den vanliga lösningen med infälld säkerhetsspärr. Men på stora öppna ytor är det som sagt både bekvämt och behändigt.

Recycler 55 AD har en funktion som kallas Quickwash och den som är mån om sina trädgårdsmaskiner kommer att uppskatta denna. I praktiken innebär funktionen att du kan koppla på en vattenslang när det är dags att rengöra aggregatet. Munstycket sprutar sedan ut vatten undertill. Och det fungerar okej, även om vi såklart ändå måste hjälpa till en del med att rensa.

Uppsamlaren är dock inte lika enkel att rengöra eftersom den är av ett tygmaterial. Däremot sparar den plats när den inte används eftersom den blir platt.

Lämnar ett fint klippresultat

Undertill ser Recycler 55 AD inte ut som en vanlig gräsklippare. Den har inte helgjuten undersida, utan är utrustad med en plåt mellan kniv och front. Där tenderar grenar och annat att fastna ibland. Vid ett tillfälle skadar vi plåten när en gren far runt där och måste lossa och banka till den igen.

En annan svaghet är klipphöjdinställningen som kräver att du justerar ett reglage vid varje hjul. Det finns idag mer användarvänliga lösningar att tillgå.

På plussidan noteras att den är lättstartad och levererar ett riktigt fint klippresultat. Den klarar blött och högt gräs bra men du får hålla ner hastigheten lite för att den ska hinna med. Hade den varit mer användarvänlig hade betyget blivit betydligt högre.

Klipphöjd: 25-102 mm (5 steg) Klippbredd: 55 cm Klippsystem: 3 i 1 (Recycler on Demand, uppsamling, sidoutkast) Motor: Briggs & Stratton Quantum 675 Effekt: 6,5 hk Material: Stål Transmission: Automatic Drive Vikt: 36,3 kg Ljudnivå: Mycket hög (ca 86,3 dB*1) Höjdinställning: Individuell, 4-punkts Uppsamlare: 60 liter textil Snabbrengöring: Ja Startsystem: Handstart Hopfällbart styre: Ja

Allt om gräsklippare

Gräsklipparen är ett av trädgårdens viktigaste arbetsredskap. Det används för att hålla gräsets längd i schack och har gjort så ända sedan den uppfanns på 1830-talet. Sedan dess har mycket hänt och nya varianter som robotgräsklipparen och åkgräsklipparen har introducerats. Därför kallas traditionella gräsklippare numera ofta ”gå bakom”-gräsklippare, för att särskilja dem.

Gå bakom-klipparna har förutom en motor antingen en rotor eller cylinder. Vissa gräsklippare har fasta, skevade knivar, andra har rörliga monterade på en centrumskiva.

Förr var det vanligt med tvåtaktsmotorer, men sedan 1960-talet dominerar fyrtaktsmotorn och idag är troligtvis en fyrtakts bensinmotor från Briggs & Stratton den vanligaste.

Nu är dock ett nytt historiskt skifte på gång. Batterigräsklipparna blir allt fler i takt med att batterierna förbättras och motorerna kan därmed göras mer kraftfulla. Idag hittar du batterigräsklippare på marknaden som är mer än tillräckliga för att klara av att klippa en medelstor trädgård ett par gånger om på en och samma laddning - dock till en saftigare prislapp än motsvarande bensinmodell.

Anledningen till att batterigräsklipparen håller på att ta över är naturligtvis att den har flera fördelar. Dels slipper du avgaser, det är bra både för miljön, dig och din trädgård. Dels går den tystare och du slipper köpa till bensin och olja. Däremot måste du förstås komma ihåg att ladda batterierna med jämna mellanrum. Det är också viktigt att litiumjon-batterier inte laddas ur helt, eller står kallt över vintern, eftersom de kan ta skada av detta.

Skillnader mellan olika typer av gräsklippare

Skillnaderna mellan olika gräsklippare reflekteras främst i hur väl de klipper högt, kraftigt och vått gräs. Det är avsevärda skillnader i hur lång tid det tar att klippa en given gräsyta, hur stor kostnaden är per klippning (bensin- och oljekostnader, eller uppladdningskostnad kontrasterat mot drifttid), hur bra klippresultatet blir och inte minst hur användarvänlig gräsklipparen är. Vissa modeller kommer till exempel åt bra runt rabatter, staket och träd medan andra gör det sämre.

Även inställning av klipphöjd och manövrerbarhet skiftar mellan modeller samt hur väl de klarar ojämnt och sluttande underlag. Det är vanligt att gräsmattan hinner växa till sig och bli decimeterhög då man är bortrest på semester. Vid långt gräs måste vissa modeller klippa gräset flera gånger eller klippa väldigt sakta för att inte bli överbelastade. Visserligen ska man egentligen inte klippa ner gräset mer än 2-3 cm per dag, men i realiteten är det få som orkar klippa så ofta.

Det är även stora skillnader i funktionsutbudet. Vissa klippare maler ner gräset, så kallad mulching. Andra saknar den här funktionen och skickar istället ut gräset i större bitar. Dessa kan du då välja att samla upp i en uppsamlare om sådan medföljer, eller skicka ut det på gräset igen genom sidoutkastet. Är bitarna stora kan du behöva gå över gräsklippet igen för att få ner det till en bra storlek ur nedbrytnings- och utseendesynpunkt.

Andra funktioner som kan variera är huruvida gräsklipparen har drivning, om drivningen sitter fram eller bak och om gräsklipparen är utrustad med flera hastighetslägen.

Olika konsumenter är också olika köpstarka. För att kunna ge köpråd till så många som möjligt har vi delat in testets kandidater i tre olika prisklasser och utnämnt en vinnare i varje prisklass enligt följande:

Budget: upp till 3 000 kr Mellan: ca 3 000-4 500 kr Premium: över 4 500 kr

Utgå från dina behov och din plånbok så kommer du att finna en lämplig och aktuell gräsklippare ur utbudet nedan.

Bra att veta om gräsklippare

Olika gräsklippartyper:

Sladdförsedda elektriska gräsklippare

För- och nackdelar:

  • Mycket låg energikostnad
  • Sparsamt och billigt underhåll tack vare elmotorn
  • Relativt låg bullernivå
  • Inga avgaser
  • Bra för miljön och hälsan
  • Ofta låg vikt

– I regel en mindre kraftfull motor än bensindrivna gräsklippare – Strömsladden kan uppfattas som besvärlig och ”i vägen” under klippning – Strömsladden begränsar avståndet man kan röra sig från strömuttaget – Elektriska gräsklippare har ofta en smalare klippbredd än bensindrivna

Batteridrivna (sladdlösa) elektriska gräsklippare

För- och nackdelar:

  • Relativt låg bullernivå
  • Ofta lättmanövrerad
  • Inga avgaser
  • Ofta relativt låg energikostnad
  • Bra för miljön och hälsan
  • Ofta låg vikt

– Mindre kraftfull motor än på bensindrivna gräsklippare – Drifttiden är ofta begränsad – Laddningstiden kan vara lång – Har ofta en smalare klippbredd än en bensindriven gräsklippare – Batteriet kan vara dyrt att byta när det är uttjänt

Robotgräsklippare

För- och nackdelar:

  • Man behöver inte klippa gräsmattan själv
  • Mycket låg energikostnad Robotgräsklippare

  • Laddar i regel sig själv i laddningsstationen när batteriet börjar ta slut

  • Gräsmattan blir normalt mycket välskött och fin, då den klipps lite men ofta
  • Kan i regel programmeras till själv-start
  • Kan ofta programmeras att hålla sig under tak vid regn
  • Låg bullernivå

– Relativt högt inköpspris – Klarar inte alltför högt gräs – Gräsmattan måste vara tämligen jämn och får inte luta för mycket – En enskild klippning tar normalt längre tid än med en traditionell gräsklippare – Långa och frekventa klippningar kan irritera ljudkänsliga grannar som störs av det låga men långvariga bullret

Bensingräsklippare

Bensingräsklipparen är den traditionella gräsklippartypen och fortfarande den vanligaste typen av gräsklippare. Även om bensingräsklipparen i grunden inte förändrats så mycket sedan 1960-talet är den fortfarande det bästa valet i många lägen.

Är gräsmattan exempelvis stor, med högt gräs, kuperad terräng och det förekommer mycket rötter och stenar är bensingräsklipparen i regel att föredra. Detta då bensingräsklippare men sina kraftfulla förbränningsmotorer fortfarande är överlägsna elektriska gräsklippare vad gäller styrka, snabbhet och uthållighet.

Priset man betalar för denna styrka är dock avgaser, vibrationer och oljud. Bensingräsklippare är nämligen den gräsklippartyp som för mest oväsen. Dessutom kräver en förbränningsmotor generellt mer underhåll än en elmotor på grund av förbränningsmotorns många rörliga delar.

För- och nackdelar:

  • Har de kraftfullaste motorerna som klarar tuffast motstånd
  • Kan klippa länge på en tankning

– Hög bullernivå – Relativt mycket underhåll – Relativt dyrt bränsle – Ohälsosamma och illaluktande avgaser – Kraftigare styrvibrationer – Hög maskinvikt – Kan upplevas klumpiga på små och hinder-rika ytor

Batterigräsklippare

De flesta batteridrivna gräsklippare drivs idag av så kallade litiumbatterier (ofta betecknade Li-Ion eller litiumjonbatterier), vilket är samma typ av batteri som används i exempelvis laptops och mobiltelefoner. Litiumbatterier klarar av att lagra väldigt mycket energi jämfört med traditionella batterier och det är tack vare dessa man numera kan driva så energikrävande maskiner som gräsklippare med batteri.

Tyvärr är litiumbatterier dyra och håller bara ett begränsat antal urladdningar. Sedan dör batteriets många celler en efter en och batterikapaciteten försämras gradvis. En batteridriven gräsklippares litiumbatteri behöver därför bytas ut efter några år, vilket kostar en slant. För bästa driftsäkerhet bör man även ha ett extrabatteri.

Byggkvalitet

Lägger man flera tusen på en gräsklippare vill man också att den ska hålla länge och kunna användas i flera år. En gräsklippare utsätts ofta för ansenliga krafter under klippning vilket medför stora påfrestningar. Att den är konstruerad för att klara långvarigt och omfattande slitage är därför viktigt om den ska hålla tillräckligt länge.

Beroende på vilken typ av gräsklippare man har varierar underhållsbehovet avsevärt. Bensindrivna gräsklippare kräver i regel mest underhåll. Dels då en förbränningsmotor med dess många rörliga delar lättare går sönder än en elmotor, dels då förbränningsmotorn kan utveckla en större kraft och med större kraftutveckling kommer större påfrestningar på utrustningen.

Hjul

Gräsklipparen ska ha stabila och hållbara hjul som är enkla att montera av. Dessutom får gärna bakhjulen vara stora eftersom gräsklipparen då är lättare att manövrera. Framhjulsdrift är att föredra framför bakhjulsdrift, då gräsklippare med framhjulsdrift är lättare att manövrera.

Klippbredd

Klippbredden skiljer sig avsevärt mellan olika gräsklippare och ligger i regel mellan 30-55 cm beroende på modell. Billigare gräsklippare har generellt en mindre klippbredd medan dyrare gräsklippare har större.

Ju större klippbredden är, desto snabbare klipper gräsklipparen då dess knivar når längre och därmed täcker en större yta. Ju större klippbredden är, desto kraftigare måste dock gräsklipparmotorn vara. För ju mer gräs den måste klippa på en gång, desto mer motstånd blir det.

Klipphöjd

Klipphöjden på gräsklippare varierar men ligger oftast över en minimihöjd på 20 mm och under en maximihöjd på 80 mm.

Egentligen räcker det för de flestas behov med en minimihöjd på 40 mm, då en gräsmatta inte ska klippas kortare än så. Detta beror på att en så kortklippt gräsmatta är känsligare vad gäller både slitage och uttorkning och därför inte är lämplig för de flesta gräsmatteägare. Begränsningar i klipphöjden är i regel därför inte något problem på en gräsklippare.

De enda gräsmattor som ska klippas kortare än 40 mm är så kallade paradgräsmattor, vilka inte ska beträdas utan endast är till för att se fina ut. Dessa gräsmattor måste till skillnad från vanliga gräsmattor (som på fackspråk kallas brukargräsmattor) skötas mycket varsamt samt vattnas regelbundet och rikligt.

En mycket låg klipphöjd sliter dessutom mer på klippaggregatet och ökar risken för att bladen skadas av stenar, rötter et cetera - speciellt om inte gräsmattan är tillräckligt jämn.

Ljudnivå

En gräsklippares bullernivå upplevs ofta som mer eller mindre besvärande av såväl den som klipper som de i omgivningen. Förutom obehag kan bullret från gräsklipparen vara direkt skadligt.

Risken för hörselskada beror dels på hur hög ljudnivån är, dels hur länge man utsätts för bullret. Arbetsmiljöverket använder sig därför av måttstocken ”Total daglig bullerexponeringsnivå” för sina riktvärden. Generellt kan man dock säga att risk för hörselskada uppkommer vid ca 85 dB(A) (decibel, A-vägt) för de flesta. Känsligheten varierar dock från person till person och har man otur kan man få hörselskador redan vid 75-80 dB(A).

Detta innebär att man bör ha på sig hörselskydd när man klipper gräset. Det enda undantaget är vid användande av robotgräsklippare, då deras buller ligger långt under Arbetsmiljöverkets gränsvärden.

Ljudnivån skiljer sig avsevärt åt mellan de olika typerna av gräsklippare. Föga förvånande är bensindrivna gräsklippare med sina förbränningsmotorer mest högljudda med ljudnivåer på uppemot 100 dB(A). Elektriska gräsklippare med sina elmotorer för normalt betydligt mindre oväsen på nedåt 90 dB(A).

Tystast är robotgräsklipparna med bullernivåer på runt 60 dB(A), inte minst för att de klipper så ofta att gräset inte hinner bli långt. Viktigt att observera är att decibel-skalan är logaritmisk vilket exempelvis innebär att ett buller på 100 dB(A) är 10 gånger så intensivt som ett buller på 90 dB(A).

Manövrerbarhet

Gräsklipparens manövrerbarhet avgör hur lätt den är att styra. De olika gräsklippar-typerna har tämligen stora skillnader vad gäller manövrerbarhet. De minsta och lättaste gräsklipparna tenderar att ha den bästa manövrerbarheten, vilket i praktiken nästan alltid innebär elgräsklippare.

Samtidigt är elgräsklippare som går på nätel kopplade till strömuttag med en strömsladd, precis som en dammsugare. Detta innebär oundvikligen en del bök då strömsladden hela tiden måste flyttas för att inte komma i vägen. Något som naturligtvis påverkar manövrerbarheten negativt.

Bensingräsklippare är däremot relativt tunga och klumpiga, vilket ger en sämre manövrerbarhet. Detta innebär att bensingräsklippare generellt sett är lämpligare för större gräsytor då manövrerbarheten är mindre viktig för denna typ av klippning.

Multiclip

Multiclip innebär att gräsklipparens knivar klipper grässtrået flera gånger i olika nivåer så att det blir mycket kort och därför lättare förmultnar. Denna teknik kallas förutom multiclip även mulching, BioClip eller multiklipp och gör ofta uppsamlingen av gräs efter klippningen överflödigt.

Dessutom återför den även vatten och näringsämnen från det klippta gräset till gräsmattan.

Tänk på att när man använder sig av multiklippning ska inte mer än ca 30% av grässtråets längd klippas. Dessutom bör inte gräset var för långt då gräsklipparen i så fall kan få svårt att orka mala ner allt gräs.

Sidoutkast

Sidoutkast (eller sidoutblås som det också kallas) innebär att gräsklipparen har ett utblås på sidan där gräsklippet kan blåsas ut. Sidoutkast är framförallt användbart när gräset är mycket högt och gräsklipparen inte hinner smula sönder gräset, så kallad multiclip.

Säkerhet

En gräsklippare med dess vassa knivar och kraftiga motor skulle vara fullständigt livsfarlig om den inte vore säkert konstruerad. Lyckligtvis är moderna gräsklippare säkra, ibland till och med så säkra att överaktiva säkerhetsfunktioner kan orsaka irritation. Alla gräsklippare i vårt test uppfyller den europeiska standarden för maskinsäkerhet.

Den kanske viktigaste säkerhetsfunktionen är det så kallade död-mans-grepp som innebär att man under klippning hela tiden håller inne en ett reglage på handtaget. När man släpper handtaget släpper man även reglaget och gräsklipparen stannar automatiskt.

Robotgräsklipparnas motsvarighet till detta är en säkerhetsfunktion som stänger av robotgräsklipparen automatiskt ifall någon lyfter upp den.

Tillförlitlighet

Liksom andra maskiner vill man naturligtvis ha en tillförlitlig gräsklippare som alltid levererar och aldrig krånglar. Samtidigt utsätts en gräsklippare för mycket hårda krafter och ofta pressas den till gränsen för vad den klarar.

Det är därför inte konstigt att det är relativt vanligt med motorstopp under gräsklippning. Ribban ska dock vara hög på en bra gräsklippare och följer man anvisningarna för dess användande ska den vara tillförlitlig.

Gräsklipparen ska också vara lätt att få igång och den som själv upplevt en traditionell bensingräsklippare som inte vill komma igång minns säkert hur irriterande detta kan vara. För att minska risken för detta har många bensingräsklippare idag elstart-funktion.

Uppsamlare

Uppsamlare är en behållare som monteras på gräsklipparen för att samla upp det klippta gräset. Uppsamlaren monteras sedan av och töms med fördel i en kompost då det ger en utmärkt mull.

En rymlig uppsamlare har naturligtvis fördelen att man inte behöver tömma den lika ofta. Praktiskt är också ett fönster i toppen på uppsamlaren eller en ljusindikator, så att man vet när det börjar bli dags att tömma den.

Vibrationer i styret

Vibrerande redskap som gräsklippare kan orsaka skador i händer och armar, vilka beror på att nerverna i händer och armar skadas av vibrationerna. Risken för skador beror dels på hur kraftiga vibrationerna är, dels hur länge man utsätter sig för vibrationerna.

Symptomen är flera men vanligt är pirrningar, stickningar, domningar och känselnedsättning eller känselbortfall i fingrar, händer och/eller armar. Skadorna är oftast övergående för de som bara utsätter sig för vibrationer sporadiskt, exempelvis vid gräsklippning någon timme i veckan. Vissa personer är dock mer känsliga än andra och har man otur kan även måttliga vibrationer under förhållande kort tid ge permanenta skador. På grund av detta vill man naturligtvis att gräsklipparens vibrationer ska vara så svaga som möjligt.

Vibrationerna från en gräsklippare mäts i regel vid styret och anges i m/s². För att skatta när skador kan uppstå har arbetsmiljöverket angett gränsvärden beroende på hur lång tid man bör utsätta sig för vibrationer, beroende på hur kraftiga vibrationerna är. För den lägsta riskklassen är dessa 8 timmar vid vibrationer på 2.0 m/s², 5 timmar vid 2.5 m/s² och 1 timme vid 5.0 m/s².

Generellt vibrerar bensingräsklippare med sina kraftiga förbränningsmotorer mest medan eldrivna gräsklippare vibrerar mindre. Bäst för den som vill undvika vibrationer är naturligtvis en robotgräsklippare.

Inte medlem? Börja här