Vi lagrar data om din användning i cookies. Genom fortsatt användning godkänner du detta

Cookiepolicy

Bästa gräsklipparen: 26 modeller i test

Profilbild
Uppdaterad 3 september 2019

Söker du efter en prisvärd gräsklippare? Vi har testat alla de hetaste gräsklipparna på marknaden och i vårt test blir Klippo Excellent bäst i test. Den briljerar med sin enorma prestanda och dess gedigna konstruktion.

Stihl RMA 443 C blir bästa batterigräsklippare eftersom den också är enormt stark och innovativ.

Bästa budgetval är AL-KO EnergyFlex 3.85 Li. Det är en lite enklare gräsklippare som orkar med betydligt mer än vad man kan tro vid första anblick.

Så gjorde vi testet

Alla modeller har långtidstestats under minst en sommar. Vi bedömde klippresultatet dels direkt efter klippning, dels efter en tids regelbundet klippande. Alla gräsklippare testades på flera olika gräsmattor med flera olika grästyper och höjder på gräset. Vi klippte även gräset i olika grader av väta.

  • Prestanda
    Vi beräknade klipphastighet, bränsleförbrukning, klippkostnad och klippkapacitet genom att klippa ett antal stora, plana gräsmattor vars areor och gräshöjder vi uppmätt.

  • Användarupplevelse
    Även bullernivåer och styrvibrationer uppmättes. Dessutom noterade vi förekomsten och intensiteten av eventuella bränsleångor.

Under testresultaten har vi gjort en komplett sammanställning över alla de egenskaper vi bedömde i vårt test av gräsklippare. Varje egenskap förklaras där i detalj och sammanställningen bildar därigenom en praktisk guide som kan läsas inför köp av gräsklippare, oavsett typ och modell.

Vi har testat ett urval av marknadens populäraste gräsklippare. Jämför pris på samtliga listade gräsklippare på PriceRunner.

1. Klippo Excellent - BÄST I TEST GRÄSKLIPPARE

Lika excellent som namnet antyder

Prisklass: Premium Kraftkälla: Bensin Motor: Briggs&Stratton Motoreffekt: 2,8 kW (vid 2 800 rpm) Tankvolym: 1 L Klipphöjd: 30-60 mm Klippbredd: 48 cm Motor: Briggs & Stratton 650EXI Vikt: 29 kg Ljudnivå: Låg | Uppmätt medelvärde: 66,1 dB Styrvibrationer: Låga Självgående: Nej Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Nej

Klippo Excellent SH Bensindriven gräsklippare

Klippo Excellent är en riktigt bra gräsklippare. Den gör, på pappret, inget större intryck. Där ser den snarare nästan lite omodern och tråkig ut. Exempelvis saknar den drivning, vilket i den här prisklassen skapar frågetecken. Väl igång inser du dock snabbt hur genomtänkt och välfungerande den här gräsklipparen är. Den rullar extremt lätt över gräsmattan och är nästan lika lättkörd som en gräsklippare med drivning.

Har du sluttande tomt blir det förstås skillnad. Men på relativt plana till lätt lutande gräsmattor märks ingen skillnad alls.

Kraftfull och bra på att mulcha

Samtidigt är prestandan grym. Högt blött gräs, sly och liknande är inga problem. Detta klarar visserligen de flesta bensingräsklippare idag. Den stora skillnaden ser man när man ökar tempot. Då lämnar många modeller tussar på gräsmattan eftersom de inte orkar med. Dessa problem har dock inte Klippo Excellent. Vi testar till och med att springa med gräsklipparen och den hinner ändå med att mulcha.

Klippo Excellent har också en smart funktion i att du kan vinkla handtaget i sidled. På så vis kan du enkelt klippa nära häck och buskar utan att själv behöva gå in i dem. Du får god kontroll över gräsklipparen.

Byggkvaliteten är gedigen och stabil. Du har exempelvis en svetsad ögla för dragsnöret. Hjulen är inte av hårdplast, utan hårdare gummi. Gummerade hjul samlar ibland på sig en del gräs, men dessa har en anordning som hjälper till att hålla dem rena.

Lite tung men annars genomtänkt

Excellent har inte mycket till svagheter men en sådan är att höjdinställningen är lite trög. Du justerar den med en spak, vilket är smidigt, men eftersom maskinen ändå är ganska tung måste du ta i en del. Du får nästan lyfta lite på gräsklipparen samtidigt med andra handen. Tyngden gör den också lite jobbig att lyfta in i förrådet. Däremot är klipparen lätt att vika ihop och förvara.

Excellent saknar uppsamlare och sidoutkast, men det behövs knappast då den är så otroligt effektiv på att mulcha. Klippo Excellent passar dig som söker en genomtänkt och driftsäker gräsklippare för stora ytor där batterigräsklippare i dagsläget inte riktigt räcker till. Den är tidseffektiv och lämnar ett utmärkt klippresultat oavsett hur fort du kör den. Har du mycket branta slänter bör du välja en annan modell, men annars är detta ett utomordentligt bra köp.

Mycket hög prestanda & byggkvalitetgenomtänkt konstruktionväldigt lättkördvinkelbara handtag
Tung höjdinställningingen drivning

Bra pris hos:

Maskinklippet.se

2. Stihl RMA 443 C - BÄSTA BATTERIDRIVNA GRÄSKLIPPARE

Fenomenal batteriklippare med användarvänliga funktioner

Prisklass: Premium (inkl batteri och laddare, exkl: mellan) Kraftkälla:Batteri Motoreffekt: 2700 W (vid 2900 rpm) Tankvolym: 1 L Klipphöjd: 25-75 mm (5 steg) Klippbredd: 46 cm Motor: Briggs & Stratton Vikt: 27 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 83 dB Styrvibrationer: Måttliga (3,5 m/s²) Justerbart handtag: Ja Multiclip: Nej (kan köpas som tillbehör) Framdrift: Ej självgående, finns som självgående med automatisk omkoppling mellan batterifack 1 och 2 och heter då PC Uppsamlare: 55 L

Stihl RMA 443 C Batteridriven gräsklippare

Stihl RMA 443 C blir med sin kombination av god klippkapacitet och genomtänkt design, till ett bra pris, bästa batteriklippare. Den är lätt att stuva undan då den kan fällas ihop så att den bara blir cirka 40-50 centimeter hög. Likaså justeras klipphöjden busenkelt genom att med ett enhandsgrepp trycka in ett handtag och dra gräsklipparens kropp upp eller ned.

RMA 443 C passar både långa och korta personer eftersom du även kan justera höjden på handtaget.

Så lätt att styra

Själva handtaget är av hårdplast, och säkerhetsspärren är infälld i plasten, vilket gör att du får ett skönt grepp när du är ute och klipper. Den är lätt att styra, mycket på grund av att den väger relativt lite.

RMA 443 C har också låga styrvibrationer och hanterar kuperad terräng utmärkt. Kåpan av högkvalitativ hårdplast klarar både sly och vanligt gräs utan att påverkas märkbart.

Klipper en stor yta

Klippbredden kan anses vara medelstor. Nu är detta fortfarande en batterigräsklippare, och med dessa följer en lite smalare klippbredd. Den stora fördelen med batterigräsklippare är deras effektivitet på mindre och mer slingriga ytor. Medan bensingräsklipparna med sin väl tilltagana klippbredd gör sig bra på stora, öppna ytor.

Stihl RMA 443 C är speciell på så vis att den saknar en nedre horisontell stång som brukar sitta på de flesta gräsklipparna. Vi uppskattar detta då det ger bättre sikt i gräsklipparens omedelbara område. Ska du till exempel runda en buske ser du direkt om du närmar dig en sten eller annat hinder. Du får också bättre översikt över själva gräsklipparen.

Den klarar att klippa angivna 1 000 kvadratmeter - även när det är någorlunda högt och grovt gräs. Den klarar också mycket grovt gräs även om det förstås påverkar batteritiden en del, dock mindre än genomsnittet. Drifttiden förblir således god vid tufft motstånd. Dessutom är RMA 443 C utrustad med dubbla batterifack, så när det ena batteriet är slut är det bara att byta plats på dem och du kan klippa ytterligare 1 000 kvadratmeter.

Ett mycket bra köp

Sammantaget är detta en riktig kraftmaskin som samtidigt har god drifttid och smarta, användarvänliga lösningar. Det är ett mycket bra köp för den som har en medelstor gräsmatta med svårigheter såsom kuperad terräng och många hinder på gräsmattan. Den levererar batterigräsklipparens alla fördelar utan att kompromissa med prestanda eller framkomlighet.

Användarvänlig designenkel klipphöjdsjusteringhög prestanda
Viss risk att klämma sig på gashandtaget

Bra pris hos:

Maskinklippet.se

3. AL-KO EnergyFlex 3.85 Li - BÄSTA BILLIGA GRÄSKLIPPARE

Användarvänlig och ergonomisk på mindre ytor

Prisklass: Budget Kraftkälla: Batteri Batteri: Typ: Lithiumjon Kapacitet: 4 Ah/40 V Uppmätt batteritid: 8,75 min/Ah Laddindikator: Ja Klippkapacitet: 250 m² Klipphöjd: 25-75 mm (6 steg) Klippbredd: 40 cm (uppmätt) Vikt: 17 kg Ljudnivå: Mycket låg (uppmätt 59,6 dB) Styrvibrationer: Låga Justerbart handtag: Ja Multiclip: Nej Uppsamlare: Ja (45 l)

AL-KO 3.85 Li Batteridriven gräsklippare

AL-KO EnergyFlex 3.85 Li är en mycket lätt och relativt stark batterigräsklippare. Handtagen är gummerade med skumgummi för bästa möjliga grepp. Chassit är av plast vilket bidrar till den låga vikten. Gräsklipparen har också ställbart handtag med två olika lägen, vilket gör att den passar såväl lång som kort.

Kombinerat med den låga vikten gör detta 3.85 Li till en användarvänlig och ergonomisk gräsklippare för en bred målgrupp.

Samtidigt är prestandan hög för att vara en så pass billig gräsklippare. Klipper du en gång i veckan under högsäsong har 3.85 Li inga problem att hinna med. Är du däremot lite slarvig och låter det växa på sig någon decimeter kan den lämna högar som du får köra över två gånger.

Eftersom den saknar mulching blir uppsamlaren extra viktig. Den är av plast upp- och nedtill med tyg emellan, vilket gör att den lättförvarad men samtidigt lite svår att få helt ren. En annan nackdel är att hjulen - trots en mycket försiktig mönstring - samlar på sig en del gräs. Du kommer att behöva göra rent hjulen med jämna mellanrum. Det blir med andra ord en del underhåll.

Lämplig för mindre ytor

AL-KO EnergyFlex 3.85 Li har en konstruktion av relativt tunn plast som inte känns påkostad. Likaså känns batterihållaren lite vek. Batteriet har laddningsindikator, men du måste böja dig ner och titta in i en lucka för att se den.

Klipphöjdjusteringen är mycket smidig. Du reglerar denna med en enda spak och den rör sig lätt och ledigt mellan de olika alternativen. Tyvärr är skalan något otydlig. Du ser siffrorna men det är lite svårt att se vilken inställning spaken står på. Du ser topp- och bottenläge, men däremellan är det lite luddigt.

AL-KO EnergyFlex 3.85 Li är en flexibel batterigräsklippare som gör sig bäst på mindre ytor. Det gör inget om gräsmattan är snårig och har många hinder eftersom klipparen är så pass lättstyrd. Dessutom är den mycket lättjusterad samt skön att hålla i tack vare skumgummigreppet.

Sköna handtagsmidig klipphöjdinställningstyrhöjdsjusteringväldigt lättstyrd
Drar på sig en del gräslite vek konstruktionotydlig klipphöjdsinställning

Bra pris hos:

Gardenstore.se

4. AL-KO Highline 51,8 SP-A - BÄSTA MELLANKLASSVAL

Lättjusterad och stark för medelstora trädgårdar

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 2100 W (vid 2 850 rpm) Klipphöjd: 30-80 mm (7 steg) Klippbredd: 51 cm Motor: AL-KO Pro Motor Vikt: 35 kg Ljudnivå: Låg | Uppmätt medelvärde: 69,9 dB Styrvibrationer: Kraftiga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Ja

AL-KO Highline 51.8 SP-A Bensindriven gräsklippare

AL-KO Highline 51,8 SP-A är en användarvänlig och ganska tidseffektiv gräsklippare. Höjdinställningen är exempelvis mycket smidig. Du har hela sju olika inställningsmöjligheter och de justeras lätt med en enda spak. Tyvärr måste du böja dig ner för att se vilken höjdinställning du valt på grund av en lite knepig placering av siffrorna. En annan välkommen funktion är kroken för startsnöret som du kan fästa en bit upp så att du slipper böja dig ner när du ska starta.

Highline 51,8 SP-A har både mulching, sidoutkast och uppsamlare så att du själv kan välja vad som passar din gräsmatta. Uppsamlaren är av hårdplast så det är lätt att rengöra den med högtryckstvätten. Gräsklipparen är mycket stark sett till sin prisklass och klarar både högt och vått gräs. I riktigt högt gräs hör vi på motorn att den får arbeta hårdare men den reder fortfarande ut det problemfritt.

Dock har den ganska kraftiga vibrationer och lite långsam drivning. Vi hade gärna sett att det gått att ställa hastigheten i fler lägen, och då gärna med ett snabbare hastighetsalternativ.

Lite haltande byggkvalitet men smidig att framföra

AL-KO Highline 51,8 SP-A har som sagt en bitvis ganska genomtänkt konstruktion men byggkvaliteten haltar något. Redan efter ett par veckors användning hänger sig nålen vilket gör att bensinen rinner ut direkt efter tankning.

Vidare så gör de ganska kraftiga vibrationerna att vingmuttrarna och kroken för startsnöret lossnar och ramlar av efter en tid. Du får gå och skruva åt dem med jämna mellanrum. Att drivremmen dessutom är placerad synlig undertill bredvid kniven känns dumt eftersom den med tiden kommer att få ta en hel del stryk. Däremot har vi inte upptäckt någon rost eller andra kärvande funktioner efter en säsong.

Bakhjulsdriften gör klipparen smidig att köra även i trädgårdar med många hinder. Dessutom får du bra grepp med däcken. Trots att Highline 51,8 SP-A är ganska tung är den lätt att vända även på små ytor. Dock kan vi tycka att den är lite onödigt lång, hjulen bygger på en hel del. Detta är förstås negativt vid vinterförvaring. Å andra sidan är den enkel att vika ihop och lyfta undan.

AL-KO Highline 51,8 SP-A passar dig som har en trädgård på omkring 2 000 kvadratmeter som vill klippa den i ett makligt tempo men samtidigt med en stor klippbredd.

Smidig höjdinställninglättstyrdfunktionsrikhög prestanda
Haltande byggkvalitetjobbiga vibrationer

Bra pris hos:

AL-KO

5. Stihl RM 448 TC

Smidig bensingräsklippare för komplicerade gräsmattor

Prisklass: Premium Motor: Briggs & Stratton Kraftkälla: Bensin Motoreffekt: 2700 W (vid 2900 rpm) Tankvolym: 1 L Klipphöjd: 25-75 mm (5 steg) Klippbredd: 46 cm Vikt: 27 kg Ljudnivå: 83 dB Styrvibrationer: Måttliga (3,5 m/s²) Framdrift: 3,5 km/h Justerbart handtag: Ja Multiclip: Nej (kan köpas som tillbehör) Uppsamlare: 55 L

Stihl RM 448 TC Bensindriven gräsklippare

Stihl RM 448 TC är en innovativ och lättmanövrerbar premiumgräsklippare och utnämns till bästa premiumval.

För att vara en bensindriven gräsklippare så har RM 448 TC en låg maskinvikt och tillsammans med framåtdriften gör det att gräsklipparen inte kräver så stor ansträngning att manövrera. Den låga maskinvikten har delvis åstadkommits genom att använda ett chassi av högkvalitativ hårdplast istället för stål. Viking lämnar 10 års garanti på plastchassit, så kvaliteten lär vara mycket hög, men som alla gräsklippare bör RM 448 TC inte förvaras i direkt solljus.

Även en klippbredd under snittet bidrar till en lägre vikt. Gräsklipparens nätthet gör det enklare att kantklippa runt buskar, träd och trädgårdsmöbler. Tillsammans med bakhjulsdriften bidrar den även till en god framkomlighet i kuperad terräng. Dock gör det förstås att det tar lite längre tid att klippa stora ytor.

Enkelt att justera den

Justering av monohandtaget och klipphöjden är båda väldigt enkla, men det finns viss risk att klämma sig på gashandtaget.

Framåtdriften är enkelväxlad, men hastigheten är väl avvägd och gräsklipparen orkar med grovt, halvlångt gräs utan att överbelastas.

Uppsamlaren är mycket smidig att komma åt tack vare monohandtaget och en mängdindikator meddelar när den är full.

RM 448 TC saknar mulching-funktion då det är tänkt att uppsamlaren alltid ska användas och så länge detta görs så ger den ett jämnt och fint klippresultat. RM 448 TC får briljera mest på medelstora till stora gräsmattor med ojämna kanter, kuperad terräng och många hinder.

Hög byggkvalitetrelativt låg vikthög komfortgoda terrängegenskaper
Viss risk att klämma sig på gashandtaget

Bra pris hos:

Gardenstore.se

6. Ryobi OLM1841H

Lättjusterad med intressant batterilösning som passar många mindre trädgårdar

Prisklass: Mellan Kraftkälla: Batteri Batteri: Typ: Lithiumjon Kapacitet: X Ah/36 V (2x18 V) Uppmätt batteritid: 10 min/Ah (dock med dubbla 18 V-batterier) Klipphöjd: 20-70 mm (5 steg) Klippbredd: 40 cm Motor: El Vikt: 22 kg Ljudnivå: Låg (ca 62,2 dB) Styrvibrationer: Låga Självgående: Nej Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Ja (50 l)

Ryobi OLM1841H Batteridriven gräsklippare

Ryobi OLM1841H är en intressant gräsklippare på så vis att den har dubbla 18-voltsbatterier. Batterierna är seriekopplade och ger därmed en spänning på 36 volt. Fördelen med denna konstruktion är att du som har 18 volts Ryobimaskiner hemma kan nyttja dem även till gräsklipparen. Detta är väldigt smidigt eftersom utbudet av verktyg i 18-voltsklassen är så stort. I och med att batterier är dyra finns här mycket pengar att spara om du håller dig till Ryobi.

En nackdel med lösningen är att den kräver viss framförhållning om båda batterierna ska dela på samma laddare. Gräsklipparen fungerar nämligen inte om inte bägge batterierna har kraft.

Tyvärr saknar OLM1841H drivning och passar därför inte dig som har tomt med kraftig slänt. Men eftersom klipparen är ganska lätt är det inga problem att använda den på plan till lätt lutande tomt.

Många funktioner

Ryobi OLM1841H är lite plastig i konstruktionen på så vis att den känns tunnare och mindre stabil än många andra batterigräsklippare med plastchassi. Men under säsongen upplever vi inga problem med skador eller liknande. Att den saknar drivning gör också att det är färre detaljer som kan gå sönder. Gräsklipparen har ett skönt grepp på handtaget och är lättjusterad. Du vinterförvarar den enkelt genom att vika handtaget.

Klipphöjdjusteringen är mycket smidig. Den sitter bra till och det räcker att du justerar den vid en enda punkt vilket sker med en stor spak. Du har fem lägen att välja mellan.

Det medföljer uppsamlare och dessutom har gräsklipparen mulching. Det gör att du får en stor variation i användningsområdena, eftersom du kan samla upp gräsklippet när gräset hunnit växa sig högre än vad mulchingen orkar med. OLM1841H:s prestanda är standard för prislappen. Så länge du håller gräsmattan klippt en gång i veckan under högsäsong orkar den mulcha vid lagom tempo. Men låter du gräset växa sig högt kommer klippparen att lämna gräshögar efter sig i mulchingläge och då är uppsamlaren ett bättre val.

Ryobi OLM1841H passar bäst för dig med en liten till medelstor – och relativt plan – gräsmatta som redan har flera 18-volts Ryobiprodukter i hemmet. Har du det är detta ett riktigt bra köp, speciellt då priset blir så lågt om du redan har batteri och laddare.

Funktionsrikkompatibel med 18-voltsbatteriertystgåendebra klippbredd
Potentiellt tidskrävande uppladdningingen drivning

Bra pris hos:

Computersalg.se

7. AL-KO Silver 524 SP-A Premium

Högpresterande allroundklippare till ett bra pris

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 2300 W (vid 2800 rpm) Tankvolym: 1,2 L Klipphöjd: 30-80 mm (7 steg) Klippbredd: 51 cm Motor: Pro 160 Quick Start Vikt: 38,5 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 82 dB Styrvibrationer: Måttliga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: 70 L

AL-KO 524 SP-A Premium Bensindriven gräsklippare

AL-KO Silver 524 SP-A Premium är en mycket bra gräsklippare tack vare sin kombination av prestanda, komfort och funktionalitet till ett överkomligt pris. Gräsklipparen är robust konstruerad med en stark motor, vilket också känns när man framför den. Den klipper effektivt högt och grovt gräs utan att behöva krypa då motorn klarar hög belastning. Därigenom hålls bensinångorna till ett minimum.

Föga förvånande innebär kraftmotorn tyvärr en bullernivå klart över medel.

Den är ergonomisk

Handtagen är vadderade och detta ger ett skönt handgrepp samt minskar styrvibrationerna, men även risken att klämma sig på byglarna. Klipphöjden justeras smidigt centralt och har många olika nivåer.

Bakhjulsdriften i kombination med de stora bakhjulen ger en god framkomlighet och ökar möjligheterna att använda framdriften. Uppsamlaren är lite plastig men vi gillar skarpt att den ingår utan extra kostnad.

Likt andra bensingräsklippare gör även denna sig bäst på okomplicerade och lite större gräsmattor, då den lätt upplevs ganska klumpig i små trädgårdar med mycket vändande och många kantytor såsom träd, buskar och murar.

Kraftfull motorrobustgoda terrängegenskaperframdriftvadderade handtagsmidig klipphöjdsjustering
Mycket hög ljudnivålite plastig uppsamlareganska klumpig på små och komplicerade ytor

Bra pris hos:

Maskinklippet

8. Honda HRX 476 C1 VYEH

Stark, innovativ och användarvänlig

Prisklass: Premium Kraftkälla: Bensin Motoreffekt: 2 700 W (vid 2 800 rpm) Tankvolym: 0,93 L Klipphöjd: 25-79 mm (7 steg) Klippbredd: 47 cm Motor: GCV160 Vikt: 39 kg Ljudnivå: Låg | Uppmätt medelvärde: 63,9 dB Styrvibrationer: Måttliga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Ja

Honda HRX 476 VYE Bensindriven gräsklippare

Honda HRX 476 C1 VYEH är en ganska kompakt premiumklippare med mycket kraft under huven och en användarvänlig, funktionsrik design. Drivningen är steglös. Du ställer hastigheten med hjälp av paddlar och dessa nås enkelt med både vänster- och högerhanden. Vidare kan du justera positionen på dem. Du kan även höja och sänka hela handtaget i tre olika steg med hjälp av en vingmutter. Det är användarvänligt så det förslår.

En annan intressant funktion är att du kan ha motorn igång utan att klippaggregatet snurrar. Det förenklar när du ska förflytta gräsklipparen från en plats till en annan och inte vill riskera att knivarna skadas - eller för den delen skadar.

Utan drivning är HRX 476 väldigt tung trots att den har plastchassi. Det gör också att det blir tungt att ställa in klipphöjden. Men själva lösningen för klipphöjdinställning är smidig. Du trycker in knapp och drar sedan upp eller ned beroende på vilken höjd du vill ha. Stegen är tydligt markerade.

Kraft och innovation Honda HRX 476 C1 VYEH är som sagt en mycket stark gräsklippare. Den klarar förstås normalförhållanden, men den kan även mulcha på hög hastighet i högt gräs utan att lämna gräshögar efter sig. Undertill hittar vi dubbelkniv vilket förmodligen är det som bidrar till att den orkar så mycket. De sitter dock inte som i ett kors utan den ena sitter lite bredvid. Det är oklart varför de valt den designen, men klippresultatet blir onekligen fint.

Du väljer mellan mulching och uppsamlare med hjälp av ett inbyggt vred. Detta är en betydligt smidigare lösning än de pluggar som många tillverkare skickar med, eftersom dessa är lätta att tappa bort. Uppsamlaren är delvis av nät och delvis av hårdplast. Det gör den tyvärr lite svår att rengöra.

HRX 476 C1 VYEH har bakhjulsdrift. Med tanke på tyngden är det bra eftersom den då ändå är lättstyrd runt hinder och liknande. Däcken har bra mönstring och får fint grepp utan att skada gräsmattan.

Överlag framstår Honda HRX 476 C1 VYEH som en smidig, användarvänlig och stark premiumklippare. Har du råd är detta ett bra köp, speciellt för dig med större trädgård som inte vill behöva klippa gräset i alltför täta intervall.

Steglös hastighetsinställningsmidig höjdinställningmycket starklättkördtystgående
Tungtyguppsamlare lite svår att få helt ren

Bra pris hos:

Gardenstore.se

9. Bosch Rotak 43 Li

Storsäljande batterigräsklippare med imponerande prestanda

Prisklass: Premium Driftkälla: Batteri Batterityp: Lithiumjon Kapacitet: 2,6 Ah/36 V Uppmätt batteritid: 11 min/Ah Laddtid: ca 60 min (80 % laddat efter ca 30 min) Laddindikator: Ja Klippkapacitet: 600 m² Klipphöjd: 20-70 mm (10 steg) Klippbredd: 43 cm Motor: El Vikt: 14 kg Ljudnivå: Mycket låg | Uppmätt medelvärde: 58,7 dB Styrvibrationer: Under medel Självgående: Nej Justerbart handtag: Ja Multiclip: Ja Uppsamlare:50 L

Bosch Rotak 43 Li Batteridriven gräsklippare

Batteridrivna gräsklippare är hetare än någonsin och Bosch Rotak 43 Li är mer än någon annan den modell som ligger bakom framgången. Klippbredden är mycket bred för en elgräsklippare men det som vi imponerades mest av är den kraftfulla motorn. Rotak 43 Li höjer nämligen ribban för vad man kan förvänta sig av en batterigräsklippare då den äter sig igenom allt man kan begära och mer därtill. Förutom blött, grovt och långt gräs även storvuxna ogräs som kirskål och hundkäx.

Samtidigt är både ljudnivå och maskinvikt låg och gräsklipparen bärs lätt av samtliga vuxna i familjen. Detta bidrar till att Rotak 43 Li är riktigt behändig vid kanter och under buskar, men gör även självdrift överflödig.

Dessutom är styrramen hopfällbar vilket gör vinterförvaringen smidigare.

Den orkar gå länge

Då Bosch skickar med två stycken batterier och en snabbladdare nästan tredubblas i praktiken drifttiden jämfört med ett batteri. Detta gör Rotak 43 Li till en utmärkt gräsklippare för små och medelstora gräsmattor.

Har man däremot en stor gräsmatta med öppna ytor passar förmodligen en gräsklippare med större klippbredd och kraftigare batteri bättre. Alternativt en bensingräsklippare vid mycket stora ytor. Har du dessutom slänt bör du välja en med drivning, vilket Rotak 43 Li saknar.

Ett riktigt kraftpaket

Förutsatt att du har en lämplig tomt för Rotak lämnar den dock ett mycket fint klippresultat, ett av de finaste vi sett. Den samlar också upp bra, har sköna och lite fräcka rallyhandtag, tydlig höjdinställning och en smidig storlek. Rotak 43 Li utgör ett riktigt kraftpaket och är en av de bästa elgräsklipparna på marknaden för mindre gräsmattor.

Relativt stor klippbreddkraftfulllätt & smidiglåg ljudnivåinga avgaserextrabatteri inkluderat
Smal klippbredd för stora gräsmattor

Bra pris hos:

Bygghemma.se

10. Stiga Multiclip 50 S AE

Mycket uthållig och stark

Prisklass: Premium Kraftkälla: Batteri Batteri: Typ: Lithiumjon Kapacitet: 5 Ah/80 V Laddindikator: Ja Klippkapacitet: 700 m² Klipphöjd: 31-75 mm (5 steg) Klippbredd: 48 cm Motor: El Vikt: 30 kg Ljudnivå: Mycket låg (ca 55,8 dB) Styrvibrationer: Låga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Nej

Stiga Multiclip 50 S AE Batteridriven gräsklippare

Stiga Multiclip 50 S AE är en mycket uthållig batterigräsklippare som kan hantera stora gräsmattor. Den klipper utan problem en betydligt större yta än de 700 utlovade kvadratmeterna. Vår testgräsmatta på 2 000 kvadratmeter klarar den utan problem på en enda laddning, detta i medelsvår terräng utan drivning.

Har du däremot drivning på och klipper i lättare slänt i ungefär lika svår terräng orkar den omkring 1 500 kvadratmeter istället. Det är dock fortfarande en ansenlig yta för en batteriklippare.

Styrkemässigt håller den en mycket hög nivå. Fuktigt, högt gräs är inga problem alls. Det är en multiclipmaskin så det ingår ingen uppsamlare, istället finfördelar den gräset och detta gör den med bravur.

Tyvärr är 50 S AE lite trög att backa för att vara en batterimodell, det har med tyngden att göra i kombination med motståndet. Men mönstringen på hjulen är bra, och ger fint grepp utan att skada gräsmattan.

Konstruktion med både för- och nackdelar

Stiga Multiclip 50 S AE har en ganska enkel men tung konstruktion. Tyvärr måste klipphöjden justeras på två olika punkter vilket vi kan tycka är lite dåligt med tanke på att detta är en premiumklippare. Men har du väl hittat en passande klipphöjdinställning går den sedan som en klocka.

Ljudnivån är mycket låg, detta är en av de mest tystgående gräsklippare vi har testat.

50 S AE håller tyvärr inte färgen särskilt bra över flera säsonger, både de röda handtagen och det gula plåtchassit har ljusnat. Gräsklipparen visar däremot inga tecken på rost.

Det märks överlag att detta är en premiumklippare - även om det finns förbättringspotential på sina håll. Dess styrka är kombinationen hög prestanda och lång uthållighet.

Stiga Multiclip 50 S AE passar dig med en stor trädgård som inte vill behöva klippa mer än max en gång i veckan under högsäsong. Den tål tuff terräng trots att den är batteridriven och har en väl tilltagen klippbredd, och har du en plan mycket stor yta kan du stänga av drivningen för att förlänga batteritiden.

Väldigt uthållighög prestandatystgåendeeffektiv mulching
Krånglig klipphöjdjusteringtappar färgtung

11. AL-KO Solo 5278 VS

Mycket hög prestanda och fin byggkvalitet

Prisklass: Premium Kraftkälla: Bensin Motoreffekt: 3 200 W (vid 2 800 rpm) Tankvolym: 1 L Klipphöjd: 30-85 mm (7 steg) Klippbredd: 51 cm Motor: Briggs & Stratton 875 EXi Vikt: 42,6 kg Ljudnivå: Låg | Uppmätt medelvärde: 69,7 dB Styrvibrationer: Måttliga Självgående: Ja (steglös hastighetsreglering) Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Ja (70 liter)

AL-KO 5278 VS Bensindriven gräsklippare

AL-KO Solo 5278 VS är en ganska användarvänlig gräsklippare med mycket hög prestanda. Den hinner med att mulcha gräset även på högsta hastighet under svåra förhållanden där vi låtit gräset växa 1-2 veckor under högsäsong. Bakhjulsdriften gör den lättstyrd trots dess tunga vikt.

Du kan steglöst ställa vilken hastighet gräsklipparen ska gå i med hjälp av en spak. Spaken kan vara lite trög, men det är en bra funktion eftersom du då kan anpassa till din gånghastighet.

Höjdinställningen är godkänd. Den styrs med en enda spak som fälls ut, men piggen som sedan ska in i de olika hålen är lite krånglig att få på plats. Dessutom är siffrorna som ska visa vilken inställning du valt svarta mot svart bakgrund så de är svåra att urskilja. Det framstår som ogenomtänkt med tanke på att detta är en premiumklassklippare.

Stort plus däremot för att det finns ett "snöre" på tanklocket som håller det kvar medan du tankar. Det är en enkel detalj som gör stor praktisk skillnad.

Uppsamlare med indikator AL-KO Solo 5278 VS har en hög byggkvalitet. Det är stabila tjocka handtag och alla funktioner som du kan interagera med är gummerade för bästa möjliga grepp - till och med handtaget för startsnöret och drivningen är gummerade. Tyvärr sitter drivremmen synlig bredvid kniven vilket gör att det finns risk för skador på denna om du har mycket bös på gräsmattan - vi hade förväntat oss en bättre lösning med tanke på priset.

Uppsamlaren är av hårdplast men kombinerad med tyg på sidorna mellan över- och underdel. Det gör att den tar mindre plats, samtidigt som den ändå tar upp mycket gräs och är enkel att städa ur. Det finns också en indikator som talar om för dig när den är full. Utöver uppsamlare har klipparen sidoutkast och mulching. Det fastnar tyvärr av någon anledning en hel del gräs i sidoutkastet.

Solo 5278 VS är mycket tung. Handtaget på chassit gör den enklare att lyfta in för vinterförvaring, men man bör ändå vara två. Den är lätt att fälla ihop och relativt tystgående under drift sett till hur stark den är.

AL-KO Solo 5278 VS passar dig som vill kunna variera hastigheten du klipper utan att nämnvärt påverka prestandan och som har en ganska stor gräsmatta som du vill kunna klippa tidseffektivt.

Smidig hastighetsregleringmycket hög prestandaergonomiska handtag
Malplacerad drivremsidoutkastet sätter igenväldigt tung

Bra pris hos:

Gardenstore.se

12. AL-KO Solo 4757 Li SP

Ett kraftpaket i batteriklassen

Prisklass: Premium Kraftkälla: Batteri Batteri: Typ: Lithiumjon Kapacitet: 7,5 Ah/42 V Uppmätt batteritid: 6 min/Ah Laddindikator:Ja Klippkapacitet: 700 m² Klipphöjd: 30-80 mm (6 steg) Klippbredd: 46 cm Motor: El Vikt: 34,3 kg Ljudnivå: Mycket låg (ca 58,4 dB) Styrvibrationer: Låga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare:Ja (70 l)

AL-KO Solo 4757 Li SP Batteridriven gräsklippare

AL-KO Solo 4757 Li SP är en riktigt stark batterigräsklippare för medelstora gräsmattor. Den hanterar det mesta vi utmanar den med, allt från högt fuktigt gräs till fallfrukt och lövhögar.

Tyvärr är batteritiden relativt kort, i synnerhet med tanke på priset. Vi hade önskat större en batterikapacitet för att klara av den höga effekten, eller åtminstone ett ekoläge som gav förbättrad batteritid genom lägre effekt. Då hade målgruppen blivit bredare och betyget högre.

4757 Li är funktionsrik. Den kommer med både uppsamlare, sidoutkast och mulching, men det förväntar vi oss å andra sidan med tanke på prisklassen. Det är en stor och bra uppsamlare som är lämplig till den här storleken på maskin.

Prestandan i paritet med en bensingräsklippare AL-KO Solo 4757 Li SP har en tydlig laddindikator som syns från din klipposition. Konstruktionen är överlag genomtänkt. Du har bra gummerat grepp. En kul funktion är att klipparen lyser upp vid beröring, ett slags svar på att den har batterikraft kvar och är redo att börja klippa. Mönstret på hjulen är lagom djupt och de ger bra grepp mot gräsmattan utan att skada den, trots gräsklipparens tyngd. Konstruktionen påminner en hel del om AL-KO:s bensinmodeller. Uppsamlaren är exempelvis likadan och chassit påminner också mycket om dessa. En skillnad är förstås batteriet. Det sitter lättillgängligt framtill - men inte särskilt skyddat.

Klipphöjden justeras med en enda spak vilket är smidigt. Det är dock lite otydlig skala, den är gömd bakom spaken och väldigt mörk så det är svårt att se vilken inställning du väljer.

Gräsklipparen är som sagt väldigt tung. Så länge du inte ska lyfta in den för vinterförvaring är detta inget problem eftersom den har bakhjulsdrift och drivning som gör den lättstyrd. Men vid vinterförvaring är det en god idé att vara två som hjälps åt. En nackdel med dess storlek är också att den kommer ta upp mycket plats i förrådet, detta även om du viker ned handtaget. En fördel är förstås att du får en ganska stor klippbredd.

AL-KO Solo 4757 Li SP är riktigt bra på stora, öppna och raka ytor. På mindre ytor, eller ytor med många buskar och andra hinder, blir den klumpig på grund av sin storlek. Har du en medelstor, ganska öppen gräsmatta som du önskar klippa mer sällan under högsäsong är Solo 4757 Li SP ett bra val, speciellt om du redan äger ett kompatibelt batteri, så att du får ner priset på klipparen.

Mycket hög prestandaTydlig batteriindikatorMycket tystgående
Något kort batteritidOtydlig klipphöjdinställning

Bra pris hos:

Gardenstore.se

13. Stihl RMA 235

Superkompakt och genomtänkt för mindre ytor

Prisklass: Mellan Kraftkälla: Batteri Klipphöjd: 25-65 mm (5 steg) Klippbredd: 33 cm Vikt: 14 kg Styrvibrationer: Måttliga Självgående: Nej Justerbart handtag: Ja (2 steg) Multiclip: Nej Uppsamlare: Ja (30 liter)

Stihl RMA 235 Batteridriven gräsklippare

Stihl RMA 235 är en mycket liten och kompakt batterigräsklippare för små ytor. Den är superlätt, mycket tystgående och kommer åt överallt - även under exempelvis låga buskar.

Trots dess lätta vikt känns den inte ranglig eller sviktande avseende byggkvaliteten. Plastchassit är av relativt kraftig plast med smidig åtkomst av batteriet och en tydlig batteriindikator. När gräsklipparen ska vinterförvaras viker du snabbt ihop den genom att skruva på en ratt och fälla ihop handtaget. Konstruktionen är överlag genomtänkt och stabil.

Gräsklipparen saknar tyvärr drivning och är därför inte lämplig om du har kraftig sluttning på tomten, men å andra gör dess låga vikt att den är enkel att skjuta framför sig både på plan gräsyta och vid måttlig lutning.

Klipphöjdjusteringen är central och sköts smidigt med en enda knapp för alla fyra hjul.

Ingen mulching, men kan dela batteri med andra Stihl RMA 235 är intressant på så vis att dess batteri fungerar med en lång rad andra Stihl-produkter, såsom motorsåg eller kraftigare grästrimmer. Många batterigräsklippare har batterier med högre spänning vilket gör att utbudet av prylar de passar tillsammans med är begränsat, men i 36-voltsklassen finns det många Stihl-maskiner och därmed ökar det kompatibla prylutbudet.

RMA 235 har bra driv i. Visst, den hinner inte med att klippa ner högt gräs jämnt om du går på i för högt tempo. Men eftersom den saknar drivning är det enkelt att anpassa tempot efter hur flitigt du har skött gräsmattan. Vid normalhögt gräs orkar den en yta på cirka 250 kvadratmeter innan det är dags att ladda batteriet.

Gräset matas till den medföljande uppsamlaren som har en indikator vilken visar när den behöver tömmas.

Tyvärr saknar RMA 235 mulching. Det är en av dess största brister eftersom bioklippning ger näring till gräsmattan utan att lämna gräshögar på den som riskerar kväva gräset under. Istället får du köra med uppsamlare, eller köra över gräsklippet flera gånger.

Vi kan tycka att priset på RMA 235 gör att den borde ha lite fler smarta funktioner, och även gummerat grepp. Men utöver få funktioner, och lite tråkigt materialval på de detaljer du interagerar med, är detta en väldigt bra gräsklippare.

Stihl RMA 235 passar dig som söker en lätt, tyst och superkompakt gräsklippare för en liten och relativt plan yta.

Tidseffektiv klippningstark motorsnyggt klippresultatlättstyrdlåg vik
Stegrar lättmanöverbygeln saknar gummihandtag

Bra pris hos:

Gårdsman

14. AL-KO Classic 5.16 VS-B Plus 625 Series E

Många funktioner i stark gräsklippare

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 2300 W Klipphöjd: 30-80 mm (central, 6 steg) Klippbredd: 51 cm Motor: B&S Series 625 E Vikt: 33,4 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 87 dB Styrvibrationer: Måttliga Självgående: Ja Justerbart handtag:Ja Multiclip: Ja Uppsamlare: 65 L

AL-KO Classic 5.16 VS-B Plus Bensindriven gräsklippare

AL-KO Classic 5.16 VS-B Plus 625 Series E är överlag en mycket kompetent gräsklippare, den känns genomtänkt och användarvänlig.

Klipphöjdjusteringen är exempelvis mycket smidig. Du justerar hela maskinkroppen med en enda spak, istället för att behöva punktjustera vid varje hjul. En annan behändig funktion är den steglösa hastighetsjusteringen. Med hjälp av vad som liknar ett litet gashandtag ställer du enkelt hastigheten. Du kan på så vis exempelvis sänka hastigheten när du ska runt besvärliga hörn och höja den igen på raksträckor.

Själva handtaget på gräsklipparen kunde dock haft bättre ergonomi. Säkerhetsspärren är inte integrerad, så det blir inte ett lika skönt grepp som det kunde ha varit.

En annan ergonomisk anmärkning är höjdjusteringen av handtaget vars två lägen båda är för höga för korta personer. Vi hade även önskat att man slapp skruva ur hela skruven för att genomföra höjdjusteringen.

En ganska användarvänlig gräsklippare

Classic 625 Series E gör ett mycket bra klipparbete. Den lämnar ett fint klippresultat och gör även ett bra arbete om du har lite pinnar, fallfrukt och annat som ligger på gräsmattan.

Gräsklipparen har så kallad 4-i-1-funktion vilket innebär att du kan klippa traditionellt med uppsamlare, men även mala ner gräset genom mulchingfunktionen. Om du inte sätter i pluggen för mulching blir det ett ganska stort glapp baktill. Detta gör att den skjuter ut en del gräsrester och grenar på fötterna när du klipper. Vi rekommenderar därför att du alltid har den i.

När vi använder uppsamlaren märker vi att den är väldigt enkel att hålla ren mellan användningarna tack vare utformning och materialval. Vi ger även plus för att det är så enkelt att backa gräsklipparen. Hade det inte varit för den haltande ergonomin, främst för korta personer, hade betyget blivit högre. Sammantaget är dock detta en riktigt bra gräsklippare.

Enkel klipphöjdjusteringsmidig hastighetsjusteringfunktionsrik
Ej anpassad för korta personerlite obekväm handtagslösning

Bra pris hos:

Verktygsproffsen.se

15. Ryobi RLM36X46H5P

Funktionsrik och lätt till rimligt pris

Prisklass: Mellan Kraftkälla: Batteri Batteri: Typ: Lithiumjon Kapacitet: 5 Ah/36 V Batteritid: 12 min/Ah (uppmätt) Laddindikator: Ja Klipphöjd: 20-70 mm (5 steg) Klippbredd: 46 cm Vikt: 19,9 kg Ljudnivå: Låg | Uppmätt medelvärde: 59 dB Styrvibrationer: Låga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Ja (55 l)

Ryobi RLM36X46H5P Batteridriven gräsklippare

Ryobi RLM36X46H5P är en batterigräsklippare med plastchassi som trots sin låga maskinvikt kommer med drivning. Drivningen är dessutom separat vilket innebär att du inte behöver ha klippaggregatet igång samtidigt. Därmed kan du enklare förflytta klipparen in i förråd och liknande utan svårigheter.

Därtill underlättas förvaringen av att klipparen är enkel att vika ihop och då blir väldigt platt. Det finns ett stort handtag på chassit så att du lätt kan lyfta upp RLM36X46H5P på ett hyllplan.

Lite halvdan byggkvalitet

Drivningen kommer väl till pass om du har tomt med slänt. På plan yta är gräsklipparen så pass lätt att du skulle ha klarat dig utan, men det gör förstås inget att drivningen finns där. Vi har lite problem med att den hoppar ur drivningen ibland. Dessutom driver den bara på ett hjul vilket inte känns helt driftsäkert.

Prestandamässigt hinner klipparen med att klippa gräsmattan under normalförhållanden. Men har det vuxit på sig ordentligt går den lite för snabbt för att hinna med, speciellt vid mulching.

För att vara en 36-voltsmaskin har RLM36X46H5P bra driv i motorn och hanterar därför blött och lite högre gräs med bravur. Batteriet kan delas med andra 36-voltsmaskiner från Ryobi och sparar dig i så fall mycket pengar. Vi gillar också att det följer med såväl uppsamlare som mulchingplugg.

Ryobi RLM36X46H5P har en något haltande byggkvalitet och utöver problemen med drivningen som ibland hoppar ur så är maskinen uppsamlaren lite klurig att få på plats.

Vidare så fastnar det en hel del gräs på hjulen. De har en mer gummiaktig yta än många konkurrenters hjul vilket eventuellt bidrar till den här effekten. I övrigt fungerar allt som det ska och det genomskinliga plastchassit ger bra överblick över batteriet.

Har hög användarvänlighet

Gräsklipparen har ett ställbart handtag vilket är positivt eftersom den då kan anpassas till personer av olika längd. Det är också lätt att sänka eller höja klipphöjden. Justeringsanordningen för detta är väldigt tydlig med hack så du kan inte missa vilken inställning du har, och den styrs med en spak vilket är smidigt.

RLM36X46H5P passar dig med en medelstor trädgård, helst med viss lutning för då kommer den till sin rätt. Den är också lättförvarad mellan klippvarven. Dels för att du kan köra den utan drivning, dels för att den blir så liten - sett till sin storlek - och behändig ihopvikt.

Både mulching & uppsamlaregod klippkapacitetseparat drivninglättförvaradenkel klipphöjdjustering
Hjulen samlar gräslite haltande byggkvalitet

Bra pris hos:

K-rauta

16. Husqvarna LC 353VI

Kraftfull premiumgräsklippare med hög komfort

Prisklass: Premium Kraftkälla: Bensin Motoreffekt: 2700 W (vid 2900 rpm) Tankvolym:1 L Klipphöjd: 25-75 mm (5 steg) Klippbredd: 53 cm Motor: Briggs & Stratton Vikt: 42 kg Ljudnivå: 82 dB (uppmätt maxvärde) Styrvibrationer: 5,3 m/s² Självgående: Ja Justerbart handtag: Ja Multiclip: Nej Uppsamlare: 60 L

Husqvarna LC 353VI Bensindriven gräsklippare

Husqvarna LC 353VI är en premium-gräsklippare som presterar bäst på större, relativt öppna ytor. Den drivs av en kraftfull Briggs & Stratton-motor som med lätthet äter sig igenom riktigt högt gräs.

LC 353VI har flera unika och praktiska funktioner. Batteristarten gör att man bara behöver trycka ner manöverbygeln för att starta klipparen. Handtaget har ett riktigt skönt grepp och kan enkelt justeras mellan två höjdlägen för bättre ergonomi.

Man kan även enkelt variera hjulens varvtal för att justera hastigheten på framdriften. Detta gör att man kan krypa vid rabatter och köra fort på öppna ytor.

Klipphöjden justeras smidigt centralt.

En intressant konstruktion

LC 353VI har en unikt designad uppsamlare med ett rör som går ut på höger sida. Denna samlar mycket effektivt upp klippt gräs och signalerar tydligt när den fyllts genom att blåsa. Detta ger ett mycket bra klippresultat och lämnar gräsmattan ren från gräsklipp.

Nackdelen med designen är att röret sticker ut från klipparen och därför kan komma i vägen när man klipper mycket nära kantobjekt, såsom träd och murar. Man får i dessa lägen därför se till att man kommer in från rätt håll så att kanten befinner sig till vänster om gräsklipparen.

LC 353VI är designad för att alltid användas med uppsamlare och har därför inte multiclip. Då detta är en stor klippare blir den lätt klumpig på små och trånga ytor.

Förträfflig byggkvalitetkraftfull motorhög komfortgoda terrängegenskaper
Uppsamlaren sänker klippkapaciteten

Bra pris hos:

Söderströms.se

17. Klippo Champion

Pålitlig trotjänare som klipper år efter år med minimalt underhåll

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 2700 W (vid 2900 rpm) Klipphöjd: 30-60 Klippbredd: 48 cm Motor: Briggs & Stratton 625e Vikt: 29 kg Ljudnivå: Hög | Uppmätt medelvärde: 77 dB Styrvibrationer: Styrvibrationer Självgående: Nej Justerbart handtag:Ja Multiclip: Ja Uppsamlare: Nej

Klippo Champion Bensindriven gräsklippare

Klippos gräsklippare är kända för sin hållbarhet och vår Klippo Champion har nu faktiskt klarat 7 säsonger utan att behöva repareras. Champion har Klippos distinkt röda färg och ger ett robust intryck.

Motorn är tillförlitlig och presterar väl under normala klippförhållanden. Är gräset däremot blött eller uppåt 10 cm högt får gräsklipparen kämpa ordentligt och motorstopp inträffar lätt om man inte går fram mycket försiktigt över gräsmattan. Så länge gräset inte är för långt gör dock den goda klippbredden att gräsklippningen går ganska fort.

Den långlivade trotjänaren

Flexibiliteten gällande klipphöjd är fullgod med flera möjliga höjdlägen som är lätta att skifta emellan. Styrvibrationerna är ganska starka och bullernivån ligger över genomsnittet, även för en bensingräsklippare. Då man alltid ska bära hörselskydd under klippning med en bensingräsklippare är detta emellertid av mindre betydelse.

För den som främst är ute efter en långlivad trotjänare som presterar år efter år är Klippo Champion ett intressant alternativ.

Mycket god hållbarhetbra klippbredd
Hög bullernivårelativt starka styrvibrationer

Bra pris hos:

Gardenstore.se

18. Stiga Turbo 48 S B

Påkostad premium-modell med hög komfort och prestanda

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 2500 W (vid 2800 rpm) Tankvolym: 1 L Klipphöjd: 25-90 mm (6 steg) Klippbredd: 46 cm Motor: Briggs & Stratton 675 EX Vikt: 36 kg Ljudnivå: Hög | Uppmätt medelvärde: 75 dB Styrvibrationer: 6,9 m/s² Självgående: Ja (3,6 km/h) Multiclip: Ja Uppsamlare: 70 L

Stiga Turbo 48 S B Bensindriven gräsklippare

Stiga Turbo 48 S B är en påkostad premium-gräsklippare med hög prestanda och funktionalitet samt en tilltalande modern design. Den kraftfulla motorn är tillverkad av Briggs & Stratton, som för gräsklipparmotorer är vad Rolls Royce är för flygplansmotorer. Klipparen äter sig därför bekymmersfritt igenom såväl högt som grovt gräs, även under självgående.

Turbo 48 S B utmärker sig också genom sin höga komfort som kommer till uttryck i både stort och smått. Med tanke på motorns höga prestanda är maskinvikten måttlig. Tillsammans med exempelvis bakhjulsdriften gör detta gräsklipparen relativt lätt att manövrera, så länge gräsmattan inte är alltför liten eller slingrig.

Lyxig så det skriker om det

Styret är höj- och sänkbart och har - liksom manöverbygeln - gummihandtag, vilket ger ett skönt grepp samt minskar klämrisken. Startsnöret har ett redigt handtag som ger ett utmärkt grepp vid start, vilket kanske bidrar till att Turbo 48 S B känns lättstartad.

Chassit har ett hål i vilket man kan koppla en vanlig vattenslang för smidig rengöring av kåpan.

Uppsamlaren är av högkvalitativ textiltyp som går att fälla ihop och en markör visar när den börjar bli full. Vi har hittills inte lyckats identifiera några egentliga brister hos Turbo 48 S B och trots sin relativt saftiga prislapp är den riktigt prisvärd. Vill man inte betala extra för lyx finns det emellertid andra modeller som ger ännu mer gräsklippare för pengarna.

Mycket kraftfull motorklipper snabbtmodern design
Klumpig på små ytorrelativt saftig prislapp

19. AL-KO Silver 468 SP-A Bio

Finfördelar gräset bra under normalförhållanden

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 2400 W (vid 2 850 rpm) Klipphöjd: 30-85 mm (4 steg) Klippbredd: 46 cm Motor: Pro Vikt: 26,9 kg Ljudnivå: Låg | Uppmätt medelvärde: 64,8 dB Styrvibrationer: Måttliga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Nej

AL-KO Silver 468 SP-A Bio Bensindriven gräsklippare

AL-KO Silver 468 SP-A Bio är en biogräsklippare som gör ett fint mulchingarbete förutsatt att gräset inte har hunnit växa sig allt för högt. Om du däremot låtit det växa på sig till omkring 1-1,5 decimeter, vilket går snabbt under högsäsong, kommer den att ha svårt att hinna med och det uppstår då gräshögar trots mulching. Men vid normalförhållanden hinner den med utan problem och den är då också ganska stark.

Klipphöjdinställningen är en smula krånglig. Spaken framtill är lite trög och baktill måste du justera genom att trycka med hela handen. Det finns smidiga lösningar där du bara behöver justera på en punkt, vilket vi tycker att en gräsklippare med den här prislappen borde ha haft.

Bioklippare med sidoutkast

Silver 468 SP-A Bio är framhjulsdriven. Detta ska ge bättre energibesparing vid mulching. Det fungerar bra så länge du inte har en komplicerad trädgård med många hinder. Annars blir framhjulsdrift en nackdel eftersom den driver sämre när du lägger tyngd mot handtaget, och eftersom du tappar driv när du ska svänga. Tyvärr är hjulen lite dåligt mönstrade, vilket också bidrar till den något negativa upplevelsen vid framförande.

AL-KO Silver 468 SP-A Bio är som sagt duktig på att finfördela gräs - förutsatt att du inte slarvar med klippningen under högsäsong - men du kan även koppla på ett sidoutkast. Har du låtit det bli högt gräs kan det vara bra att koppla på det som ett mellansteg, och sedan gå över igen med mulching. Det ingår tyvärr ingen uppsamlare.

Silver 468 SP-A Bio rullar lätt över gräsmattan i ett lagom tempo. Den är inte särskilt tung. Vidare är den enkel att förstå sig på och enkel att skruva isär för vinterförvaring.

Byggkvaliteten är inte dålig, men kunde samtidigt varit bättre. Gräsklipparen har visserligen hållit bra men redan efter en säsong är den solblekt och vi hittar lite rost på vingmuttrar och reglage. Dessutom sitter drivremmen synlig undertill vid klippaggregatet vilket gör att det lätt kan uppstå skador på den om du kör över stenar, grova grenar och liknande.

Silver 468 SP-A Bio passar dig som har en gräsmatta i storlek omkring 1 000-1 500 kvadratmeter med inte allt för många hinder på. Den rullar ganska lätt och har godkänd prestanda under normalförhållanden.

Ganska bra mulchingenkel att förstå sig pålättkörd
Krånglig höjdinställningslirarbitvis haltande byggkvalitet

Bra pris hos:

Gardenstore.se

20. MTD OPTIMA 46 SPB HW

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 1900 W (vid 2800 rpm) Klipphöjd: 28-92 mm (6 steg) Klippbredd: 46 cm Motor: Briggs & Stratton Vikt: 33 kg Ljudnivå: Hög (ca 78 dB*1) Styrvibrationer: Kraftiga Hastighet: 0-3,6 km/h Justerbart handtag: Ja Multiclip: Ja Uppsamlare: 60 l Bruksanvisning: PDF Videoklipp: Demo

MTD Optima 46 SPB HW Bensindriven gräsklippare

MTD Optima 46 SPB HW är en pigg, självgående bensingräsklippare med stora bakhjul och bakhjulsdrift, en kombination som gör att den rör sig smidigt även över kuperad tomt. Den är även enkel att manövrera runt hinder.

Trots bra mönster på hjulen tenderar den dock att slira lite vid medelhögt, tjockt gräs. Den har också problem att få gräsmattan perfekt klippt på raksträckor då den tenderar att missa en del grässtrån som lägger sig ner när den far fram. Gräsklipparen håller dock en lagom gånghastighet.

Har flera funktioner

På det stora hela får klippresultatet godkänt, speciellt sett till hur bra den maler ner nedblåsta kvistar och grenar som kommer i dess väg.

Optima 46 SPB HW har 3-i-1-funktion vilket innebär att den kommer med både uppsamlare, mulchingfunktion och sidoutkast. Du kan med andra ord välja att antingen samla upp gräsklippet, skicka ut det på gräsmattan eller finklippa och finfördela det över gräsmattan.

Gällande ergonomi och byggkvalitet är det lite dåligt grepp på drivningen. Däremot tycker vi om munstycket på chassit som kan kopplas till trädgårdsslangen, då detta förenklar rengöring av aggregatet.

Vibrerar tyvärr en del

Gräsklipparen dras tyvärr med rätt kraftiga maskinvibrationer. Vi får känningar i handlederna redan efter cirka 500 kvadratmeter klippt yta. Vid ett tillfälle vibrerar sig tanklocket till och med löst.

På plussidan noteras dock att gräsklipparen är smidig och lätt, åtminstone för en bensingräsklippare. Vi blir imponerade över dess styrka med tanke på hur nätt den är.

Optima 46 SPB HW är också riktigt enkel att justera klipphöjden på tack vare den centrala höjdjusteringen.

Sammantaget är den här gräsklipparen ett bra och prisvärt köp för en genomsnittlig villatomt med en del hinder på. Det känns som att MTD har sparat in smart för att få ner priset, du får mycket kraft och en lättmanövrerad gräsklippare men dock med något försvagad ergonomi.

Nätt storleklätt att manövreraenkel rengöring
Slirar i högt gräsmycket vibrationer

Bra pris hos:

Buildor

21. Electrolux Flymo Turbo 400

Innovativ el-gräsklippare som imponerar på hinderrika gräsmattor

Prisklass: Budget Kraftkälla: Nätel Motoreffekt: 1500 W Klipphöjd: 15-41 Klippbredd: 40 cm Vikt: 7,8 kg Ljudnivå: Mycket hög | Uppmätt medelvärde: 83 dB Styrvibrationer: Måttliga (2,72 m/s²) Självgående: Nej Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Nej

Flymo Turbo 400 Elnätsdriven gräsklippare

Den klassiska luftkuddeklipparen Flymo uppfanns redan på 60-talet av svensken Karl Dahlman, inspirerad av dåtidens nymodighet svävaren. Tekniken bygger på att rotorblad bildar en luftström som skapar en luftkudde under gräsklipparen och får denna att stabilt sväva över marken. Detta ger Flymo en rad unika fördelar vilka troligen är anledningen till att denna annorlunda gräsklippare överlevt tämligen oförändrad i nästan 50 år.

Passar bra i kuperad terräng

Flymo är utmärkt för kuperade gräsytor där vanliga gräsklippare lätt skär sönder gräsmattan. Då den saknar hjul rör Flymo sig med lätthet i alla riktningar, vilket är fantastiskt smidigt i trädgårdar med mycket hinder, såsom växter, stolpar eller kringelkrokiga kanter.

En låg maskinvikt och hopfällbarhet gör den utrymmesbesparande och enkel att hänga upp på väggen.

Se till att klippa i tid

Flymo presterar som bäst när gräset klipps regelbundet och tenderar att likt en helikopter böja grässtråna nedåt när de vuxit sig långa. Samtidigt får den inte motorstopp utan betar sakta men säkert av även högt gräs.

I och med de batteridrivna gräsklipparnas intåg har Flymo nu emellertid fått formidabel konkurrens. En batteridriven gräsklippare är nämligen starkare och betar därmed av längre gräs betydligt snabbare. Dessutom har den batteridrivna gräsklipparen ingen sladd som ständigt måste justeras.

Flymo presterar som bäst på en mindre gräsmatta som klipps ofta och som har ojämnt eller sluttande underlag.

Lågt pris & viktbillig i driftbra på ojämna & hinderrika gräsmattortar lite plats
Sladdbundenlångsam på långt gräs

Bra pris hos:

Hemmy.se

22. AL-KO Gudenaa L45-7

Unik motordriven cylindergräsklippare för skonsammare klippning

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 2300 W Klipphöjd:15-40 mm (7 steg) Klippbredd: 45 cm Motor: Briggs & Stratton Series 550 Vikt: 34 kg Styrvibrationer: Måttliga Självgående: Ja Justerbart handtag: Ja Multiclip: Nej Uppsamlare: Tillval

AL-KO Gudenaa L45-7 Bensindriven gräsklippare

Gudenaa L45-7 från tyska AL-KO är något så ovanligt som en motordriven cylinderklippare och motivet är att förena det bästa ur två världar. Handdrivna gräsklippare är av typen cylindergräsklippare och cylinderknivarna gör ett skarpare snitt, vilket är skonsammare mot gräset. Det finns emellertid även en baksida av denna kombination och den stavas viktfördelning.

Även om maskinvikten i sig är normal för en motordriven gräsklippare så framstår Gudenaa i många situationer som tung då all tyngd fördelas på endast två hjul och en kort maskinkropp. Detta gör att gräsklipparen riskerar att köra fast i ojämnheter eller trasa sönder gräs på lös jordmån.

Gör bra ifrån på plant underlag

Givet att underlaget är tillräckligt jämnt och fast så presterar emellertid Gudenaa bra och känslan av att rusa fram över gräset med en självgående cylinderklippare är riktigt berusande.

Vi hade däremot gärna sett fler växlar, speciellt för lägre hastigheter. Räkna därför med att det tar några klippningar att lära sig hantera gräsklipparen på bästa sätt.

Gudenaa saknar multiclip-funktion vilket gör att den lättare äter sig igenom högt och tjockt gräs. Vill man inte ha gräs liggandes på gräsmattan efter klippning bör man dock köpa till uppsamlare.

Självgående cylinderklippningklarar högt & grovt gräs
Kräver jämnt och fast underlagsjälvdriften kan upplevas väl snabb

Bra pris hos:

Hemmy.se

23. Honda HRG 466 SKEP

Stark och lättstyrd men inte så innovativ

Prisklass: Mellan Kraftkälla: Bensin Motoreffekt: 2 700 W (vid 2 800 rpm) Tankvolym: 0,91 L Klipphöjd: 20-74 mm (6 steg) Klippbredd: 46 cm Motor: GCV160 Vikt: 32 kg Ljudnivå: Låg | Uppmätt medelvärde: 68,2 dB Styrvibrationer: Måttliga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Ja (55 l)

Honda HRG 466 SKEP Bensindriven gräsklippare

Honda HRG 466 SKEP är en stark gräsklippare med dubbla knivar undertill som lämnar ifrån sig ett fint klippresultat även i tuff terräng. Mulchingen styr du med ett reglage istället för sedvanlig plugg, och det är smidigt både ur hanteringssynpunkt och att du inte riskerar tappa bort den.

Gräsklipparen har bakhjulsdrift och bra drivning vilket gör den är lätt att styra på slingriga gräsmattor, och att navigera runt hinder. Har du inte drivningen igång är klipparen ganska svårrullad.

HRG 466 SKEP har godkänd klipphöjdinställning även om det finns en del svagheter. Dels handlar det om att det är svårt att läsa av vilken inställning som valts eftersom det saknas siffror, dels att den främre spaken är lite trög. Med tanke på prislappen hade vi hellre sett en central klipphöjdinställning som sköttes via en enda punkt. Men lösningen med två punkter för justering fungerar ändå acceptabelt.

Mycket kraft, mindre innovation Honda HRG 466 SKEP har hög byggkvalitet. Den dras inte med jobbiga vibrationer, och trots plåtchassi är den inte jättetung - dock långt ifrån en lättviktare. Vi hade gärna sett gummerat grepp på handtaget, men själva drivfunktionen ger lagom motstånd vid ihoptryckning.

Uppsamlaren är en tygkorg vilket är praktiskt vid vinterförvaring men mindre bra i underhållsväg eftersom det är svårt att få den ren. Dessutom rymmer den inte jättemycket.

HRG 466 SKEP är lättstartad även när den stått ett tag, men det är lite trögt att rycka i snöret jämfört med en del andra modeller. Överlag hade vi förväntat oss mer innovation och genomtänkta lösningar för en premiumklassmodell. Detta är en kompetent gräsklippare med mycket riv i, men den når inte upp till fullvärdig användarvänlighet på alla punkter.

HRG 466 SKEP passar därför främst dig som vill ha mycket kraft och bra drivning.

Lättkörd med drivningsmidigt mulching-reglagemycket kraft
Trist materialval på handtagetotydlig & lite trög höjdinställningsvårrengjord tyguppsamlare

Bra pris hos:

Gardenstore.se

24. Stihl RMA 2 RT

Ekoläge och dubbla batterifack

Prisklass: Premium Kraftkälla: Batteri Batteri: Typ: Lithiumjon Uppmätt batteritid: 10 min/Ah (normalläge), 13 min/Ah (ekoläge) Laddindikator: Ja Klippkapacitet: 500 m² Klipphöjd: 28-85 mm (4 steg) Klippbredd: 46 cm Motor: El Vikt: 23 kg Ljudnivå: Låg (ca 59,7 dB) Styrvibrationer: Låga Självgående: Ja Justerbart handtag: Ja Multiclip: Ja Uppsamlare: Nej

Stihl RMA 2 RT Batteridriven gräsklippare

Stihl RMA 2 RT är en biogräsklippare med ett ekoläge som gör att den orkar längre på välklippt gräsmatta, samtidigt som den kan mata på med högre styrka om du slarvat med klippningen och låtit gräsmattan växa till sig. Dessutom har den här gräsklipparen dubbla batterifack. Tar batteriet slut kan du då snabbt byta till ett nytt - förutsatt att du köpt till ett extrabatteri och laddat upp det. Eftersom den använder sig av 36-voltsbatteri kan du dela batteri med en rad andra produkter från samma tillverkare.

Framhjulsdriften i kombination med en ganska låg vikt gör att det är lätt att du med din egen vikt rubbar balansen så att klipparen stegrar och då riskerar att slira mot gräsmattan istället för att driva framåt. Det blir också svårare att svänga eftersom du då tappar drivning, alternativt måste lyfta upp den baktill.

Drivningen är annars riktigt bra för att vara en framhjulsdriven gräsklippare. Den får bra fäste mot gräsmattan utan att skada denna, så länge du inte lägger för mycket av din egen vikt mot handtaget. Hjulen samlar heller inte på sig någon större mängd gräs.

Prestandan är bra. Den klarar angivna 500 kvadratmeter på en laddning vid normalhögt gräs och drivning påslagen trots en ganska rejält tilltagen klippbredd. Vid högt gräs får den svårt att hinna med att mulcha och du kan behöva gå över ytan två gånger. Å andra sidan har den bra klippbredd.

Saknar central klipphöjdjustering

Stihl RMA 2 RT är som sagt en ganska lätt gräsklippare. Designen är genomtänkt och byggkvaliteten hög. Plåtchassit visar inga tecken på rost efter säsongen. Det är mycket lätt att fälla ihop klipparen för vinterförvaring eftersom den har verktygslösa vikhandtag.

Klipphöjdjusteringen är däremot under all kritik sett till prisklassen. Framtill räcker det att du justerar med en enda spak, men baktill måste du trycka ner hela hjulstången för att kunna justera nivån och den ska sedan in i ett av fyra olika lägen. Det som blir krångligt är att du måste trycka hjulaxeln på respektive sida upp eller ner klick för klick. Det är onödigt omständligt, speciellt sett till hur smidig klipphöjdjustering Stihls gräsklippare brukar ha.

Vi saknar också uppsamlare och tycker att det borde ingå sett till priset. Gräshanteringen blir mer mångfacetterad och passar fler personer om du själv kan välja mulching eller uppsamlare.

Stihl RMA 2 RT är innovativ i och med de dubbla batterifacken, ekoläget och den smidiga lösningen för vinterförvaring. Men samtidigt föråldrad i sin klipphöjdjustering och snål avseende gräshanteringen. Den känns överlag som en ganska standard gräsklippare, och inte så premium som priset antyder. Dock orkar den klippa nästan dubbelt så stor yta som angiven om du stänger av drivningen, vilket onekligen är ett stort plus. Så har du en stor plan gräsyta och söker en gräsklippare med ekoläge är det här ett godkänt köp.

Stor klippyta med avstängd drivningdubbla batterifackrelativt bra prestanda
Krånglig klipphöjdinställningsaknar uppsamlare

Bra pris hos:

Gardenstore.se

25. AL-KO Moweo 46,5 Li

För den som vill hålla enkla ytor i trim

Prisklass: Mellan Kraftkälla: Batteri Batteri: Typ: Lithiumjon Kapacitet: 4 Ah/36 V Laddtid: 90 min Laddindikator: Ja Klippkapacitet: 500 m² Klipphöjd: 25-75 mm (6 steg) Klippbredd: 46 cm Motor: El Vikt: 30 kg Ljudnivå: 82,7 Styrvibrationer: Låga Självgående: Nej Justerbart handtag: Nej Multiclip: Ja Uppsamlare: 70 L

AL-KO Moweo 46.5 Li Batteridriven gräsklippare

AL-KO Moweo 46,5 Li är en lite annorlunda batterigräsklippare. På grund av batteridrivna gräsklippares relativt svaga motoreffekt så har dessa normalt en sparsam klippbredd och plastchassi för att minska belastningen på motorn. Moweo 46,5 Li har däremot en fullt normal klippbredd och ett plåtchassi. I kombination med de stora bakhjulen gör detta att gräsklipparen känns rejäl men också klumpig, speciellt för en batterigräsklippare.

Klumpigheten märks främst när du måste svänga tvärt, exempelvis runt pallkragar, träd och liknande. Det är synd eftersom batterigräsklippare ofta annars gör sig lite extra bra på slingriga små ytor, jämfört med stora öppna där bensingräsklipparna ofta har en fördel. Det är däremot relativt enkelt att klippa rakor och de stora bakdäcken gör den lättrullad.

Den är inte så stark

Så länge gräset inte är särskilt högt gör den ett fullgott klippjobb. Den maler sönder gräset fint och klipper 500 kvadratmeter yta utan problem. Får gräset däremot växa till sig upp emot 10 centimeter så får Moweo 46,5 Li svårare att orka med. Batteriet tar då slut ganska fort. Batteriets status kan du se på den tydliga batteriindikatorn.

Uppsamlingen får godkänt. Torra löv och liknande samlas upp bra, men är det tyngre arbete såsom fuktiga löv måste du sakta ner och gå långsammare för att få med allt. Ett stort plus när det kommer till uppsamlingen är att behållaren är av hårdplast. Det gör att den är stabil i formen och av ett glatt material så den är enkel att spola rent med högtryckstvätten. Den har också ganska rikligt med håligheter och sätter därför inte igen. En nackdel med den är att det krävs tvåhandsgrepp för att lossa den.

Användarvänlighet

Ur ergonomisk och praktisk synvinkel får Moweo 46,5 Li knappt godkänt. Dels måste du justera klipphöjden på tre separata ställen och det krävs dessutom en del kraft eftersom spaken går trögt. Dels kan du inte på något enkelt sätt justera handtagets höjd. Antingen har gräsklipparen därmed rätt höjd för dig, eller så får du använda dig av rallygrepp och placera händerna på sidan när du kör den.

Vi uppskattar höjden som anpassad för personer av medellängd.

Moweo 46,5 Li har låga styrvibrationer och det får den plus för. En fördel med batterigräsklippare är just den att du slipper avgaser och att du får lägre styrvibrationer. Det som främst drar ner betyget är att den är svårstyrd på slingrigare ytor. Moweo 46,5 Li passar därför bäst för dig som har en medelstor och okomplicerad gräsmatta och som sällan ändrar klipphöjd.

Enkel uppsamlarrengöringlättrullad på raka ytoringa avgaser
Tung i svängarsämre i tuff terrängtrög justering av klipphöjd

Bra pris hos:

Buildor.se

26. Toro Recycler 55 AD

Tar mycket i ett svep men krånglig klipphöjdinställning

Prisklass: Premium Klipphöjd: 25-102 mm (5 steg) Klippbredd: 55 cm Klippsystem: 3 i 1 (Recycler on Demand, uppsamling, sidoutkast) Motor: Briggs & Stratton Quantum 675 Effekt: 6,5 hk Material: Stål Transmission: Automatic Drive Vikt: 36,3 kg Ljudnivå: Mycket hög (ca 86,3 dB*1) Höjdinställning: Individuell, 4-punkts Uppsamlare: 60 liter textil Snabbrengöring: Ja Startsystem: Handstart Hopfällbart styre: Ja

Toro Recycler 55 AD Bensindriven gräsklippare

Toro Recycler 55 AD har en rejält tilltagen klippbredd vilket gör att du kan klippa en större del av gräsmattan på kortare tid än normalt.

Den kommer med både mulching, uppsamlare och sidoutkast, du kan med andra ord finfördela gräset direkt eller samla upp löv med mera. Det gör den här gräsklipparen mångsidig. Dessutom krävs ingen separat plugg för mulchingen, istället styrs detta smidigt med ett reglage. Gräsklipparen har även en säkerhetsfunktion som gör att det inte far ut sten och annat mot dig.

Rätt så ovanliga lösningar

Drivningen på Toro Recycler 55 AD är dock en vattendelare. Istället för den vanliga lösningen med en säkerhetsspärr som fälls in vid handtaget måste du trycka handtaget framåt för att få igång drivningen. På en stor öppen yta är detta mycket behändigt. Men på ytor med många hinder medför det problem. Vanligen lyfter man gräsklipparen lite när man ska runda hinder på gräsmattan eller vända. Gör du det med denna gräsklipparen gasar du eftersom det uppstår en situation där handtaget automatiskt trycks framåt. Den är också väldigt trög att backa. Det gör att komplicerade trädgårdar genast blir betydligt mer svårjobbade än vad de hade varit med den vanliga lösningen med infälld säkerhetsspärr. Men på stora öppna ytor är det som sagt både bekvämt och behändigt.

Recycler 55 AD har en funktion som kallas Quickwash och den som är mån om sina trädgårdsmaskiner kommer att uppskatta denna. I praktiken innebär funktionen att du kan koppla på en vattenslang när det är dags att rengöra aggregatet. Munstycket sprutar sedan ut vatten undertill. Och det fungerar okej, även om vi såklart ändå måste hjälpa till en del med att rensa.

Uppsamlaren är dock inte lika enkel att rengöra eftersom den är av ett tygmaterial. Däremot sparar den plats när den inte används eftersom den blir platt.

Lämnar ett fint klippresultat

Undertill ser Recycler 55 AD inte ut som en vanlig gräsklippare. Den har inte helgjuten undersida, utan är utrustad med en plåt mellan kniv och front. Där tenderar grenar och annat att fastna ibland. Vid ett tillfälle skadar vi plåten när en gren far runt där och måste lossa och banka till den igen.

En annan svaghet är klipphöjdinställningen som kräver att du justerar ett reglage vid varje hjul. Det finns idag mer användarvänliga lösningar att tillgå.

På plussidan noteras att den är lättstartad och levererar ett riktigt fint klippresultat. Den klarar blött och högt gräs bra men du får hålla ner hastigheten lite för att den ska hinna med. Hade den varit mer användarvänlig hade betyget blivit betydligt högre.

Lättstartadsmidig mulchingswitchbra rengöringsfunktion
Trög backkrånglig klipphöjdinställning

Bra pris hos:

Buildor.se

Allt om gräsklippare

Gräsklipparen är ett av trädgårdens viktigaste arbetsredskap. Det används för att hålla gräsets längd i schack och har gjort så ända sedan den uppfanns på 1830-talet. Sedan dess har mycket hänt och nya varianter som robotgräsklipparen och åkgräsklipparen har introducerats. Därför kallas traditionella gräsklippare numera ofta ”gå bakom”-gräsklippare, för att särskilja dem.

Gå bakom-klipparna har förutom en motor antingen en rotor eller cylinder. Vissa gräsklippare har fasta, skevade knivar, andra har rörliga monterade på en centrumskiva.

Förr var det vanligt med tvåtaktsmotorer, men sedan 1960-talet dominerar fyrtaktsmotorn och idag är troligtvis en fyrtakts bensinmotor från Briggs & Stratton den vanligaste.

Nu är dock ett nytt historiskt skifte på gång. Batterigräsklipparna blir allt fler i takt med att batterierna förbättras och motorerna kan därmed göras mer kraftfulla. Idag hittar du batterigräsklippare på marknaden som är mer än tillräckliga för att klara av att klippa en medelstor trädgård ett par gånger om på en och samma laddning - dock till en saftigare prislapp än motsvarande bensinmodell.

Anledningen till att batterigräsklipparen håller på att ta över är naturligtvis att den har flera fördelar. Dels slipper du avgaser, det är bra både för miljön, dig och din trädgård. Dels går den tystare och du slipper köpa till bensin och olja. Däremot måste du förstås komma ihåg att ladda batterierna med jämna mellanrum. Det är också viktigt att litiumjon-batterier inte laddas ur helt, eller står kallt över vintern, eftersom de kan ta skada av detta.

Skillnader mellan olika typer av gräsklippare

Skillnaderna mellan olika gräsklippare reflekteras främst i hur väl de klipper högt, kraftigt och vått gräs.

Det är avsevärda skillnader i hur lång tid det tar att klippa en given gräsyta, hur stor kostnaden är per klippning (bensin- och oljekostnader, eller uppladdningskostnad kontrasterat mot drifttid), hur bra klippresultatet blir och inte minst hur användarvänlig gräsklipparen är. Vissa modeller kommer till exempel åt bra runt rabatter, staket och träd medan andra gör det sämre.

Även inställning av klipphöjd och manövrerbarhet skiftar mellan modeller samt hur väl de klarar ojämnt och sluttande underlag. Det är vanligt att gräsmattan hinner växa till sig och bli decimeterhög då man är bortrest på semester. Vid långt gräs måste vissa modeller klippa gräset flera gånger eller klippa väldigt sakta för att inte bli överbelastade. Visserligen ska man egentligen inte klippa ner gräset mer än 2-3 cm per dag, men i realiteten är det få som orkar klippa så ofta.

Det är även stora skillnader i funktionsutbudet. Vissa klippare maler ner gräset, så kallad mulching. Andra saknar den här funktionen och skickar istället ut gräset i större bitar. Dessa kan du då välja att samla upp i en uppsamlare om sådan medföljer, eller skicka ut det på gräset igen genom sidoutkastet. Är bitarna stora kan du behöva gå över gräsklippet igen för att få ner det till en bra storlek ur nedbrytnings- och utseendesynpunkt.

Andra funktioner som kan variera är huruvida gräsklipparen har drivning, om drivningen sitter fram eller bak och om gräsklipparen är utrustad med flera hastighetslägen.

Olika konsumenter är också olika köpstarka. För att kunna ge köpråd till så många som möjligt har vi delat in testets kandidater i tre olika prisklasser och utnämnt en vinnare i varje prisklass enligt följande:

Budget: upp till 3 000 kr Mellan: ca 3 000-4 500 kr Premium: över 4 500 kr

Utgå från dina behov och din plånbok så kommer du att finna en lämplig och aktuell gräsklippare ur utbudet nedan.

För- och nackdelar med olika gräsklippartyper

När du ska köpa en gräsklippare är det viktigt att du väljer en typ som passar dina behov, din tomt och din plånbok.

Elektrisk klippare

Sladdförsedda elektriska gräsklippare drivs genom att du ansluter dem till ett strömuttag. Passar på små gräsmattor med nära till strömuttag, för den den som vill hålla sig till en så billig gräsklippare som möjligt.

Fördelar:

  • Mycket låg energikostnad
  • Sparsamt och billigt underhåll tack vare elmotorn
  • Relativt låg bullernivå
  • Inga avgaser
  • Bra för miljön och hälsan
  • Ofta låg vikt

Nackdelar

  • I regel en mindre kraftfull motor än bensindrivna gräsklippare
  • Strömsladden kan uppfattas som besvärlig och ”i vägen” under klippning
  • Strömsladden begränsar avståndet man kan röra sig från strömuttaget
  • Elektriska gräsklippare har ofta en smalare klippbredd än bensindrivna

Batteridriven gräsklippare

De flesta batteridrivna gräsklippare drivs idag av så kallade litiumbatterier (ofta betecknade Li-Ion eller litiumjonbatterier), vilket är samma typ av batteri som används i exempelvis laptops och mobiltelefoner. Litiumbatterier klarar av att lagra väldigt mycket energi jämfört med traditionella batterier och det är tack vare dessa man numera kan driva så energikrävande maskiner som gräsklippare med batteri.

Tyvärr är litiumbatterier dyra och håller bara ett begränsat antal urladdningar. Sedan dör batteriets många celler en efter en och batterikapaciteten försämras gradvis. En batteridriven gräsklippares litiumbatteri behöver därför bytas ut efter några år, vilket kostar en slant. För bästa driftsäkerhet bör man även ha ett extrabatteri.

Fördelar:

  • Relativt låg bullernivå
  • Ofta lättmanövrerad
  • Inga avgaser
  • Ofta relativt låg energikostnad
  • Bra för miljön och hälsan
  • Ofta låg vikt

Nackdelar:

  • Mindre kraftfull motor än på bensindrivna gräsklippare
  • Drifttiden är ofta begränsad
  • Laddningstiden kan vara lång
  • Har ofta en smalare klippbredd än en bensindriven gräsklippare
  • Batteriet kan vara dyrt att byta när det är uttjänt

Bensingräsklippare

Bensingräsklipparen är den traditionella gräsklippartypen och fortfarande den vanligaste typen av gräsklippare. Även om bensingräsklipparen i grunden inte förändrats så mycket sedan 1960-talet är den fortfarande det bästa valet i många lägen.

Är gräsmattan exempelvis stor, med högt gräs, kuperad terräng och det förekommer mycket rötter och stenar är bensingräsklipparen i regel att föredra. Detta då bensingräsklippare men sina kraftfulla förbränningsmotorer fortfarande är överlägsna elektriska gräsklippare vad gäller styrka, snabbhet och uthållighet.

Priset man betalar för denna styrka är dock avgaser, vibrationer och oljud. Bensingräsklippare är nämligen den gräsklippartyp som för mest oväsen. Dessutom kräver en förbränningsmotor generellt mer underhåll än en elmotor på grund av förbränningsmotorns många rörliga delar.

Fördelar:

  • Har de kraftfullaste motorerna som klarar tuffast motstånd
  • Kan klippa länge på en tankning

Nackdelar:

  • Hög bullernivå
  • Relativt mycket underhåll
  • Relativt dyrt bränsle
  • Ohälsosamma och illaluktande avgaser
  • Kraftigare styrvibrationer
  • Hög maskinvikt
  • Kan upplevas klumpiga på små och hinder-rika ytor

Robotgräsklippare

Robotgräsklipparen har fördelen att du själv inte behöver ta dig tid att klippa gräset. Du ställer in ett schema och sedan håller robotklipparen din gräsmatta i trim. Det gäller dock att du köper en robot som klarar din gräsmatta, annars kommer du få springa och sköta robotgräsklipparen varje dag istället för gräsmattan.

Fördelar:

  • Man behöver inte klippa gräsmattan själv
  • Mycket låg energikostnad Robotgräsklippare
  • Laddar i regel sig själv i laddningsstationen när batteriet börjar ta slut
  • Gräsmattan blir normalt mycket välskött och fin, då den klipps lite men ofta
  • Kan i regel programmeras till själv-start
  • Kan ofta programmeras att hålla sig under tak vid regn
  • Låg bullernivå

Nackdelar:

  • Relativt högt inköpspris
  • Klarar inte alltför högt gräs
  • Gräsmattan måste vara tämligen jämn och får inte luta för mycket
  • En enskild klippning tar normalt längre tid än med en traditionell gräsklippare
  • Långa och frekventa klippningar kan irritera ljudkänsliga grannar som störs av det låga men långvariga bullret

Se vårt stora test av robotgräsklippare för mer viktig information om den här produktgruppen.

Köpa gräsklippare: Byggkvalitet

Lägger man flera tusen på en gräsklippare vill man också att den ska hålla länge och kunna användas i flera år. En gräsklippare utsätts ofta för ansenliga krafter under klippning vilket medför stora påfrestningar. Att den är konstruerad för att klara långvarigt och omfattande slitage är därför viktigt om den ska hålla tillräckligt länge.

Beroende på vilken typ av gräsklippare man har varierar underhållsbehovet avsevärt. Bensindrivna gräsklippare kräver i regel mest underhåll. Dels då en förbränningsmotor med dess många rörliga delar lättare går sönder än en elmotor, dels då förbränningsmotorn kan utveckla en större kraft och med större kraftutveckling kommer större påfrestningar på utrustningen.

Köpa gräsklippare: Hjul

Gräsklipparen ska ha stabila och hållbara hjul som är enkla att montera av. Dessutom får gärna bakhjulen vara stora eftersom gräsklipparen då är lättare att manövrera. Framhjulsdrift är att föredra framför bakhjulsdrift, då gräsklippare med framhjulsdrift är lättare att manövrera.

Köpa gräsklippare: Välja klippbredd

Klippbredden skiljer sig avsevärt mellan olika gräsklippare och ligger i regel mellan 30-55 cm beroende på modell. Billigare gräsklippare har generellt en mindre klippbredd medan dyrare gräsklippare har större.

Ju större klippbredden är, desto snabbare klipper gräsklipparen då dess knivar når längre och därmed täcker en större yta. Ju större klippbredden är, desto kraftigare måste dock gräsklipparmotorn vara. För ju mer gräs den måste klippa på en gång, desto mer motstånd blir det.

Köpa gräsklippare: Klipphöjd

Klipphöjden på gräsklippare varierar men ligger oftast över en minimihöjd på 20 mm och under en maximihöjd på 80 mm.

Egentligen räcker det för de flestas behov med en minimihöjd på 40 mm, då en gräsmatta inte ska klippas kortare än så. Detta beror på att en så kortklippt gräsmatta är känsligare vad gäller både slitage och uttorkning och därför inte är lämplig för de flesta gräsmatteägare. Begränsningar i klipphöjden är i regel därför inte något problem på en gräsklippare.

De enda gräsmattor som ska klippas kortare än 40 mm är så kallade paradgräsmattor, vilka inte ska beträdas utan endast är till för att se fina ut. Dessa gräsmattor måste till skillnad från vanliga gräsmattor (som på fackspråk kallas brukargräsmattor) skötas mycket varsamt samt vattnas regelbundet och rikligt.

En mycket låg klipphöjd sliter dessutom mer på klippaggregatet och ökar risken för att bladen skadas av stenar, rötter et cetera - speciellt om inte gräsmattan är tillräckligt jämn.

Köpa gräsklippare: Ljudnivå

En gräsklippares bullernivå upplevs ofta som mer eller mindre besvärande av såväl den som klipper som de i omgivningen. Förutom obehag kan bullret från gräsklipparen vara direkt skadligt.

Risken för hörselskada beror dels på hur hög ljudnivån är, dels hur länge man utsätts för bullret. Arbetsmiljöverket använder sig därför av måttstocken ”Total daglig bullerexponeringsnivå” för sina riktvärden. Generellt kan man dock säga att risk för hörselskada uppkommer vid ca 85 dB(A) (decibel, A-vägt) för de flesta. Känsligheten varierar dock från person till person och har man otur kan man få hörselskador redan vid 75-80 dB(A).

Detta innebär att man bör ha på sig hörselskydd när man klipper gräset. Det enda undantaget är vid användande av robotgräsklippare, då deras buller ligger långt under Arbetsmiljöverkets gränsvärden.

Ljudnivån skiljer sig avsevärt åt mellan de olika typerna av gräsklippare. Föga förvånande är bensindrivna gräsklippare med sina förbränningsmotorer mest högljudda med ljudnivåer på uppemot 100 dB(A). Elektriska gräsklippare med sina elmotorer för normalt betydligt mindre oväsen på nedåt 90 dB(A).

Tystast är robotgräsklipparna med bullernivåer på runt 60 dB(A), inte minst för att de klipper så ofta att gräset inte hinner bli långt. Viktigt att observera är att decibel-skalan är logaritmisk vilket exempelvis innebär att ett buller på 100 dB(A) är 10 gånger så intensivt som ett buller på 90 dB(A).

Köpa gräsklippare: Manövrerbarhet

Gräsklipparens manövrerbarhet avgör hur lätt den är att styra. De olika gräsklippar-typerna har tämligen stora skillnader vad gäller manövrerbarhet. De minsta och lättaste gräsklipparna tenderar att ha den bästa manövrerbarheten, vilket i praktiken nästan alltid innebär elgräsklippare.

Samtidigt är elgräsklippare som går på nätel kopplade till strömuttag med en strömsladd, precis som en dammsugare. Detta innebär oundvikligen en del bök då strömsladden hela tiden måste flyttas för att inte komma i vägen. Något som naturligtvis påverkar manövrerbarheten negativt.

Bensingräsklippare är däremot relativt tunga och klumpiga, vilket ger en sämre manövrerbarhet. Detta innebär att bensingräsklippare generellt sett är lämpligare för större gräsytor då manövrerbarheten är mindre viktig för denna typ av klippning.

Köpa gräsklippare: Multiclip

Multiclip innebär att gräsklipparens knivar klipper grässtrået flera gånger i olika nivåer så att det blir mycket kort och därför lättare förmultnar. Denna teknik kallas förutom multiclip även mulching, BioClip eller multiklipp och gör ofta uppsamlingen av gräs efter klippningen överflödigt.

Dessutom återför den även vatten och näringsämnen från det klippta gräset till gräsmattan.

Tänk på att när man använder sig av multiklippning ska inte mer än ca 30% av grässtråets längd klippas. Dessutom bör inte gräset var för långt då gräsklipparen i så fall kan få svårt att orka mala ner allt gräs.

Köpa gräsklippare: Sidoutkast

Sidoutkast (eller sidoutblås som det också kallas) innebär att gräsklipparen har ett utblås på sidan där gräsklippet kan blåsas ut. Sidoutkast är framförallt användbart när gräset är mycket högt och gräsklipparen inte hinner smula sönder gräset, så kallad multiclip.

Köpa gräsklippare: Säkerhet

En gräsklippare med dess vassa knivar och kraftiga motor skulle vara fullständigt livsfarlig om den inte vore säkert konstruerad. Lyckligtvis är moderna gräsklippare säkra, ibland till och med så säkra att överaktiva säkerhetsfunktioner kan orsaka irritation. Alla gräsklippare i vårt test uppfyller den europeiska standarden för maskinsäkerhet.

Den kanske viktigaste säkerhetsfunktionen är det så kallade död-mans-grepp som innebär att man under klippning hela tiden håller inne en ett reglage på handtaget. När man släpper handtaget släpper man även reglaget och gräsklipparen stannar automatiskt.

Robotgräsklipparnas motsvarighet till detta är en säkerhetsfunktion som stänger av robotgräsklipparen automatiskt ifall någon lyfter upp den.

Köpa gräsklippare: Tillförlitlighet

Liksom andra maskiner vill man naturligtvis ha en tillförlitlig gräsklippare som alltid levererar och aldrig krånglar. Samtidigt utsätts en gräsklippare för mycket hårda krafter och ofta pressas den till gränsen för vad den klarar.

Det är därför inte konstigt att det är relativt vanligt med motorstopp under gräsklippning. Ribban ska dock vara hög på en bra gräsklippare och följer man anvisningarna för dess användande ska den vara tillförlitlig.

Gräsklipparen ska också vara lätt att få igång och den som själv upplevt en traditionell bensingräsklippare som inte vill komma igång minns säkert hur irriterande detta kan vara. För att minska risken för detta har många bensingräsklippare idag elstart-funktion.

Köpa gräsklippare: Uppsamlare

Uppsamlare är en behållare som monteras på gräsklipparen för att samla upp det klippta gräset. Uppsamlaren monteras sedan av och töms med fördel i en kompost då det ger en utmärkt mull.

En rymlig uppsamlare har naturligtvis fördelen att man inte behöver tömma den lika ofta. Praktiskt är också ett fönster i toppen på uppsamlaren eller en ljusindikator, så att man vet när det börjar bli dags att tömma den.

Köpa gräsklippare: Vibrationer i styret

Vibrerande redskap som gräsklippare kan orsaka skador i händer och armar, vilka beror på att nerverna i händer och armar skadas av vibrationerna. Risken för skador beror dels på hur kraftiga vibrationerna är, dels hur länge man utsätter sig för vibrationerna.

Symptomen är flera men vanligt är pirrningar, stickningar, domningar och känselnedsättning eller känselbortfall i fingrar, händer och/eller armar. Skadorna är oftast övergående för de som bara utsätter sig för vibrationer sporadiskt, exempelvis vid gräsklippning någon timme i veckan.

Vissa personer är dock mer känsliga än andra och har man otur kan även måttliga vibrationer under förhållande kort tid ge permanenta skador. På grund av detta vill man naturligtvis att gräsklipparens vibrationer ska vara så svaga som möjligt.

Vibrationerna från en gräsklippare mäts i regel vid styret och anges i m/s². För att skatta när skador kan uppstå har arbetsmiljöverket angett gränsvärden beroende på hur lång tid man bör utsätta sig för vibrationer, beroende på hur kraftiga vibrationerna är. För den lägsta riskklassen är dessa 8 timmar vid vibrationer på 2.0 m/s², 5 timmar vid 2.5 m/s² och 1 timme vid 5.0 m/s².

Generellt vibrerar bensingräsklippare med sina kraftiga förbränningsmotorer mest medan eldrivna gräsklippare vibrerar mindre. Bäst för den som vill undvika vibrationer är naturligtvis en robotgräsklippare.

Kommentera

Håll dig till ämnet, håll en god ton och visa respekt för andra. Vi tar bort inlägg som vi bedömer olämpliga.

Det finns ännu inga kommentarer. Bli först med att kommentera!