Vi lagrar data om din användning i cookies. Genom fortsatt användning godkänner du detta

Cookiepolicy
  1. Bmw service Biltillbehör

Bmw service Biltillbehör

(100+)

iCarsoft BMM V1.0 Felkodsläsare BMW & Mini

iCarsoft BMM V1.0 Felkodsläsare BMW & Mini

iCarsoft BMM V1.0 Felkodsläsare BMW & Mini Nollställer i stort sett alla felkoder på din BMW eller Mini. Den perfekta felkodsläsaren och bildiagnos för BMW. Ny version och efterföljare till i910-II. iCarsoft Felkodsläsare Vi säljer enbart original iCarsoft med garanti och support direkt från tillverkaren. * Klarar de flesta BMW med OBD2-kontakt. * Komplett diagnos på alla system. * Nollställer dags för service, byta olja. * Läser och nollställer DTC. * Läser Live Data. * Har stöd för batteritest. * Kan återge data och skriva ut felkodersinfo via dator. En felkodsläsare som hittar i stort sätt allt på din BMW eller Mini. De system som stöds är tex motor, Automatåda, ABS, Airbag, AC, Kombiinstrument, Elektriskt. startspärr systemet, mm. Finns i olika färger, färgen på din läsare slumpas. Den här felkodsläsaren klarar av att släcka servicelampan. Lyser din servicelampa "dags för service lampan" trots att du har bytt olja eller servat din bil. Om du sköter din bil själv eller har en verkstad så är det bra att kunna släcka servicelampan / återställa servicelampan efter gjord service. Funkar på de flesta BMW mellan 1997 och uppåt, antalet system som går att komma åt skiljer mellan årsmodellerna. Inte alla system går att komma åt på alla modeller. Efter 2001 så funkar den på nästa alla BMW. Felkodsläsare BMW och Mini klarar till exempel av * Läser och raderar felkoder DTC * Visar information live och grafisk data på en färgskärm med snabb realtidsuppdatering. * Visar BMW ECU information. * Testar komponenter och system. * Användarmanual på engelska * 170cm OBD II kabel * USB kabel för uppdatering, kontakta oss för hjälp. Läsen av nedan system... DMEEGSABSSRSIHKA/IHKRIKE/IKI/KOMBIEMLSPM/SMEWSZKE GRPDCSZMBITLSZ/LCMLEWRADEHC/EDCBMAICNAVMFLVIDSESMIDSHD SMFSPMBTSPMFTVTGCIDEPSSBSLSBSRCVMSIMSMBURSRDCVMXVNC EKMDWAXENFHKGSAAHKADSCASDMEEGSVTCHPFIACCARSCIMDSC EDCEHCEMFRDCAHLAHMAMPASKSZM/BZMFBZMCDCD-GWSG-FDSG-FD- GWFDCDCCONFCONDWAFBIIHKAFKAHKLJBITKHIKOMLMDVD-CNAV JNAVPDCCAPM/MPMRLS...

1 049 kr

Fri frakt

Runns webshop
iCarsoft i910-II Felkodsläsare BMW & Mini

iCarsoft i910-II Felkodsläsare BMW & Mini

iCarsoft i910-II Felkodsläsare BMW & Mini Nollställer i stort sett alla felkoder på din BMW eller Mini. Den perfekta felkodsläsaren och bildiagnos för BMW. Obs, andra generationen av i910 som även klarar Servicelampan, att det är dags att tex byta olja på många BMW och Mini modeller. iCarsoft Felkodsläsare Vi säljer enbart original iCarsoft med garanti och support direkt från tillverkaren. En felkodsläsare som hittar i stort sätt allt på din BMW eller Mini. De system som stöds är tex motor, Automatåda, ABS, Airbag, AC, Kombiinstrument, Elektriskt. startspärr systemet, mm. Den här felkodsläsaren klarar av att släcka servicelampan. Lyser din servicelampa "dags för service lampan" trots att du har bytt olja eller servat din bil. Om du sköter din bil själv eller har en verkstad så är det bra att kunna släcka servicelampan / återställa servicelampan efter gjord service. Denna felkodsläsare / Bilscanner / Diagnosinstrument funkar på de här BMW modellerna. Funkar på de flesta BMW mellan 1997 och uppåt, antalet system som går att komma åt skiljer mellan årsmodellerna. Inte alla system går att komma åt på alla modeller. 1 Series 1' E81, E82, E87, E88. 3 Series 3' Z3, E36, E46, E90, E91, E92, E93. 5 Series 5' E39, E60, E61, GT, F07, F10, F11. 6 Series 6' E63, E64, F11, F12, F13 7 Series 7' E38, E65, E66, F01, F02, F03, F04 X Series X1 E84X3 E83, X5 E53, X5 E70, X6 E71 Z Series 3 Z3_E36Z4 E85, E86, Z4 E89 MINI: MINI R50, R52, R53, MINI R55, R56 Nollställer även att det är dags att serva bilen, servicelampan på nedan modeller, fler kommer. 1 Series 1' E81, E82, E87, E88 3 Series 3' E90, E91, E92, E93 5 Series 5' E60, E61 6 Series 6' E63, E64 7 Series 7' E65, E66 X Series X1 E84, X5 E70X6 E71 MINI MINI R55, R56 Felkodsläsare BMW och Mini klarar till exempel av * Läser och raderar felkoder DTC * Visar information live och grafisk data på en 2.8" färgskärm med snabb realtidsuppdatering. * Visar BMW ECU information. * Testar komponenter och system. * Användarmanual på engelska *...

1 069 kr

Fri frakt

Runns webshop
iCarsoft BMM V2.0 Felkodsläsare BMW & Mini

iCarsoft BMM V2.0 Felkodsläsare BMW & Mini

iCarsoft BMM V2.0 Felkodsläsare BMW & Mini Nollställer i stort sett alla felkoder på din BMW eller Mini. Den perfekta felkodsläsaren och bildiagnos för BMW. Ny version och efterföljare till i910-II. iCarsoft Felkodsläsare Vi säljer enbart original iCarsoft med garanti och support direkt från tillverkaren. iCarsoft BMM V2.0 BMM V2.0 är ett professionellt och kraftfullt fordonsfelsdiagnosverktyg som utvecklats av iCarsoft Technology Inc. Med en 4-tums LCD-skärm och unik diagnostisk mjukvara, har den en fullständig diagnos med ett enda fordon och testlägen omfattar: CANBUS, ISO9141, KWP2000 , J1850 etc. Det gör det möjligt för tekniker att exakt diagnostisera komplexa problem. Diagnoserar, läser och tar bort / nollsställer felkoder och instrumentpanelens varningsljus, såsom: * SRS airbag varningslampa * Kontrollera Motorvarningslampan - Check engine * Transmission / Växellåda / Automatlåda * ABS-varningslampa * Antispin / Tractioncontrol * Glödstiftets varningslampa * EPC-varningslampa * Parkeringssensorns varningslampa * Suspension / Hjulupphängning * Servostyrning * VVS / Luftkonditioneringssystem * Olje Service Återställ / Dags för service * DPF regenerering och återställning * SAS Styrvinkeln återställs * EPB Öppna och stäng bromsok / byta bromsbackar * Nytt batteri Återställ / Registrera nytt batteri. * ABS-luftning. * Injector programmering. Mycket mycket mer ... ICarsoft BMM V2.0 läser även LIVE DATA Funktioner BMM V2.0 kan läsa och rensa felkoder på alla system som motor, kraftöverföring, ABS och krockkudde etc. DPF Regeneration & Reset Registrering och återställning av nytt batteri Kontrollera motorljusdiagnos och återställ Oljesevicemeddelande / Intervallåterställning Styrvinkel Sensor Diagnose & Återställ ETCS Diagnose & Återställ / Electronic throttle control Elektronisk parkeringsbroms (EPB) Diagnos & Återställ Läs Live Data Stream Full ECU-diagnos Gäller alla modeller av BMW & Mini enligt nedan Oljeljus / serviceåterställning: Återställning av servicel...

1 459 kr

Fri frakt

Runns webshop
autoaid® Pro Car Diagnostic Tool for BMW & MINI – Herstellerspezifischen Depth Diagnostic & Service Reset, CODING, Base Settings, etc.

autoaid® Pro Car Diagnostic Tool for BMW & MINI – Herstellerspezifischen Depth Diagnostic & Service Reset, CODING, Base Settings, etc.

Autoaid Pro for BMW and Mini is part of the car diagnostic system for any workshop and can be used on all ambitious BMW screwdrivers. Quick find the errors with your BMW & MINI Please note that all control units (ECUs error memory read, error erase, sensors, link, Service Rücksteller, making adjustments, parking brake and many more for all BMW models with OBD 2 connector from approx. 1999 2015 Extension of the support BMW models: 1, 2, 3, 4, 5, 6, 7, X1, X3, X5, X6, Z4, Z8 and much more. Made in Germany – Best diagnostic Depth and the best service The autoaid diagnostic tool is used and developed by our company in Germany and is only available from us. Only in this way we can ensure high quality of our product and service for all our customers: with all about the installation, function. + Vehicle Coverage we are looking forward to hearing from you. Box Contents Vehicle Interface with OBD II compliant and USB port Diagnostic software download access data System Requirements PC/Laptop/Tablet with windows (from windows 7) Internet connection for all purposes except OBDII All the advantages at a glance: – High-performance Depth diagnostic at a fraction of the high street retail price – Leben Slanges use right – kein update forced – Product Support tariff to: 030/46 7777 50 Universal: Other brands Easy zubuchbar

1 577 kr

Frakt okänd

Amazon DE
Mishimoto BMW F30 Prestanda Luftintag, 2012+ Silver

Mishimoto BMW F30 Prestanda Luftintag, 2012+ Silver

Mishimoto BMW F30 Prestanda Luftintag, 2012+ SilverPassar till: 2014-2016 BMW 228i Base 2.0 Liter GA8HP45Z 2014-2016 BMW 228i Base 2.0 Liter GA8HP45Z 2013-2015 BMW 320i Base 2.0 Liter GA8HP45Z 2013-2015 BMW 320i Base 2.0 Liter S6-17BG 2012-2013 BMW 328i Base 2.0 Liter GA6-L45R 2012-2013 BMW 328i Base 2.0 Liter GA6-L45R 2012-2013 BMW 328i Base 2.0 Liter GA6HP19Z 2012-2013 BMW 328i Base 2.0 Liter GA6HP19Z 2012-2015 BMW 328i Base 2.0 Liter GA8HP45Z 2012-2015 BMW 328i Base 2.0 Liter GA8HP45Z 2012-2015 BMW 328i Base 2.0 Liter GA8HP45Z 2012-2015 BMW 328i Base 2.0 Liter S6-17BG 2012-2015 BMW 328i Base 2.0 Liter S6-17BG 2012-2015 BMW 328i Base 2.0 Liter S6-17BG 2012-2013 BMW 328i Base 3.0 Liter GA6-L45R 2012-2013 BMW 328i Base 3.0 Liter GA6HP19Z 2012-2013 BMW 328i Base 3.0 Liter GA8HP45Z 2012-2013 BMW 328i Base 3.0 Liter S6-17BG 2014-2015 BMW 428i Base 2.0 Liter GA8HP45Z 2014-2015 BMW 428i Base 2.0 Liter GA8HP45Z 2014-2015 BMW 428i Base 2.0 Liter S6-17BG 2014-2015 BMW 428i Base 2.0 Liter S6-17BGProduktbeskrivning: Mishimoto has developed a performance air intake engineered specifically for the 2012+ BMW F30 w/ N20/N26 engines! This Performance Air Intake is safe to use with the stock tune as it will not hurt air/fuel ratios under load. This intake has a unique and aggressive tone under acceleration and boost, and the free-flowing design amplifies turbocharger spool and BPV sounds. Check out the video to hear the tone. The stock intake duct is utilized to provide cool airflow to the Mishimoto High-Flow Oiled Air Filter, which features increased filtration surface area compared to the stock paper filter. This filter can be cleaned and reused, providing a lifetime of service. The intake includes an enclosed airbox that collects all of the cold outside air from the front of the engine. The airbox is made from 5052 aluminum with a black powder-coated finish to reduce weight compared to a steel intake box, and to prevent against any corrosion. The airbox also protects against ...

5 164 kr
5 202 krinkl. frakt
L-M-R
Mishimoto BMW F30 Prestanda Luftintag, 2012+ Svart

Mishimoto BMW F30 Prestanda Luftintag, 2012+ Svart

Mishimoto BMW F30 Prestanda Luftintag, 2012+ SvartPassar till: 2014-2016 BMW 228i Base 2.0 Liter GA8HP45Z 2014-2016 BMW 228i Base 2.0 Liter GA8HP45Z 2013-2015 BMW 320i Base 2.0 Liter GA8HP45Z 2013-2015 BMW 320i Base 2.0 Liter S6-17BG 2012-2013 BMW 328i Base 2.0 Liter GA6-L45R 2012-2013 BMW 328i Base 2.0 Liter GA6-L45R 2012-2013 BMW 328i Base 2.0 Liter GA6HP19Z 2012-2013 BMW 328i Base 2.0 Liter GA6HP19Z 2012-2015 BMW 328i Base 2.0 Liter GA8HP45Z 2012-2015 BMW 328i Base 2.0 Liter GA8HP45Z 2012-2015 BMW 328i Base 2.0 Liter GA8HP45Z 2012-2015 BMW 328i Base 2.0 Liter S6-17BG 2012-2015 BMW 328i Base 2.0 Liter S6-17BG 2012-2015 BMW 328i Base 2.0 Liter S6-17BG 2012-2013 BMW 328i Base 3.0 Liter GA6-L45R 2012-2013 BMW 328i Base 3.0 Liter GA6HP19Z 2012-2013 BMW 328i Base 3.0 Liter GA8HP45Z 2012-2013 BMW 328i Base 3.0 Liter S6-17BG 2014-2015 BMW 428i Base 2.0 Liter GA8HP45Z 2014-2015 BMW 428i Base 2.0 Liter GA8HP45Z 2014-2015 BMW 428i Base 2.0 Liter S6-17BG 2014-2015 BMW 428i Base 2.0 Liter S6-17BGProduktbeskrivning: Mishimoto has developed a performance air intake engineered specifically for the 2012+ BMW F30 w/ N20/N26 engines! This Performance Air Intake is safe to use with the stock tune as it will not hurt air/fuel ratios under load. This intake has a unique and aggressive tone under acceleration and boost, and the free-flowing design amplifies turbocharger spool and BPV sounds. Check out the video to hear the tone. The stock intake duct is utilized to provide cool airflow to the Mishimoto High-Flow Oiled Air Filter, which features increased filtration surface area compared to the stock paper filter. This filter can be cleaned and reused, providing a lifetime of service. The intake includes an enclosed airbox that collects all of the cold outside air from the front of the engine. The airbox is made from 5052 aluminum with a black powder-coated finish to reduce weight compared to a steel intake box, and to prevent against any corrosion. The airbox also protects against e...

5 164 kr
5 202 krinkl. frakt
L-M-R
iCarsoft BMM V2.0 for BMW / Mini

iCarsoft BMM V2.0 for BMW / Mini

Professionellt multisystems diagnostikverktyg BMM V2.0iCarsoft BMM V2.0 är ett professionellt och kraftfullt fordonsfelsdiagnosverktyg som utvecklats av iCarsoft Technology Inc. Med en 4.0-tums LCD-skärm och unik diagnostisk mjukvara har den full diagnos av ett fordon och testlägen, inklusive: CANBUS, ISO9141, KWP2000 och J1850 etc. Det gör det möjligt för tekniker att noggrant diagnostisera komplexa problem.Produktfunktioner:1. ICarsoft BMM V2.0 kan göra allt-läser och rensar problemkoder på de flesta system som motor, överföring, ABS och krockkudde etc.2. Stödjer OBDII / EOBD Tio driftssätt3. Läser av Live Data4. Fullständig ECU-diagnos5. Passar de flesta modeller som är utrustade med OBDII-16 DLC6. Lätt att använda med silikonnycklar7. Oljeljus / Serviceåterställning: Återställ servicelampan.8. Underhåll av elektronisk parkeringsbroms (EPB) -system avaktiverar och återaktiverar EPB-systemet för utbyte och initialisering.9. Batterihanteringssystem (BMS), registrerar nytt batteri till BMS när batteriet byts ut.10. Regenereringskontrollsystem för dieselpartikelfilter (DPF), begär DPF-regenereringsprocessen vid DPF-blockering och stäng av DPF-indikatorn.11. Elektroniskt gashandelsystem (ETC) återställer reglervärdet för gasventil när du tar bort eller byter gasventilen.12. SAS: Kalibrering av styrvinkeln (SAS), kalibrerar ratten rakt framåt, eller kalibrerar SAS samtidigt som man byter ut styrenheten.13. Funktionen Utskriftsdata gör det möjligt att skriva ut diagnostiska data inspelade av skannverktyget eller anpassade testrapporter.14. Batterietestet låter dig få batterispänningen med OBD-porten med hjälp av scanningsverktyget när motorn startar.15. DTC-bibliotek för att leta upp när användaren använder detta verktyg.16. Uppgradering via PC.17. Flerspråkig: Engelska, Tyska, Holländska, Spanska, Franska. Svenska (uppdatering krävs).Femton stora fördelarDiagnosera enda märke av de flesta modeller (OBDII-16DLC)Full systemdiagnosStöd olja service återställningElektro...

1 459 kr

Fri frakt

24.se
Mishimoto BMW 330i Prestanda Luftfilterkit, 2001-2006 Svart

Mishimoto BMW 330i Prestanda Luftfilterkit, 2001-2006 Svart

Mishimoto BMW 330i Prestanda Luftfilterkit, 2001-2006 SvartPassar till: 2001-2003 BMW 330Ci Base 3.0 Liter 5HP-19 2003-2006 BMW 330Ci Base 3.0 Liter 5L40-E 2001-2003 BMW 330Ci Base 3.0 Liter S5D310Z 2004-2006 BMW 330Ci Base 3.0 Liter S6-37BZ 2004-2005 BMW 330Ci Base 3.0 Liter S6S37BZ 2001-2003 BMW 330i Base 3.0 Liter 5HP-19 2003-2005 BMW 330i Base 3.0 Liter 5L40-E 2006 BMW 330i Base 3.0 Liter A6HP19Z 2001-2003 BMW 330i Base 3.0 Liter S5D310Z 2004-2006 BMW 330i Base 3.0 Liter S6-37BZ 2004-2006 BMW 330i Base 3.0 Liter S6-37BZ 2004-2005 BMW 330i Base 3.0 Liter S6S37BZ 2001-2005 BMW 330xi Base 3.0 Liter 5L40-E 2006 BMW 330xi Base 3.0 Liter GA6HP19Z 2006 BMW 330xi Base 3.0 Liter GS6X37BZ 2001-2003 BMW 330xi Base 3.0 Liter S5D310Z 2004-2005 BMW 330xi Base 3.0 Liter S6X37BZProduktbeskrivning: Mishimoto has developed a performance air intake engineered specifically for the 2001--2006 BMW E46 330i. This E46 intake is safe to use with the stock tune as it will not hurt air/fuel ratios under load. This intake has a unique and aggressive tone, and the free-flowing design amplifies engine induction sounds. The stock E46 intake duct is utilized to provide cool airflow to the high-flow Mishimoto oiled air filter, which features increased filtration surface area compared to the stock paper filter. This filter can be cleaned and reused, providing a lifetime of service. The E46 intake includes a steel heatshield with pre-assembled rubber trim to keep hot engine air out and help draw cold outside air in. This unit is a complete bolt-on that functions perfectly with the stock tune and can be installed in one hour using common hand tools. This performance E46 intake kit is also fully functional with the Mishimoto Silicone E46 Intake Hoses. As with all Mishimoto E46 parts, this kit includes the Mishimoto Lifetime Warranty, ensuring superior product quality and craftsmanship.År 2003 grundades Mishimoto som idag är världens ledande företag inom prestanda kylningsprodukter till vardagsbi...

3 262 kr
3 300 krinkl. frakt
L-M-R
Mishimoto BMW E46 Prestanda Luftfilterkit, 1999-2005 Svart

Mishimoto BMW E46 Prestanda Luftfilterkit, 1999-2005 Svart

Mishimoto BMW E46 Prestanda Luftfilterkit, 1999-2005 SvartPassar till: 1999-2000 BMW 323i Base 2.5 Liter 250 1999 BMW 323i Base 2.5 Liter 4L30-E 2000 BMW 323i Base 2.5 Liter 5HP-19 1999-2000 BMW 323i Base 2.5 Liter 5L40-E 2001-2005 BMW 325i Base 2.5 Liter 5HP-19 2001-2005 BMW 325i Base 2.5 Liter 5L40-E 1999 BMW 328i Base 2.8 Liter 4L30-E 2000 BMW 328i Base 2.8 Liter 5HP-19 1999-2000 BMW 328i Base 2.8 Liter 5L40-E 1999-2000 BMW 328i Base 2.8 Liter S5D310ZProduktbeskrivning: "Mishimoto has developed a performance air intake engineered specifically for the 1999--2005 BMW E46 323i/325i/328i. This intake is safe to use with the stock tune as it will not hurt air/fuel ratios under load. This intake has a unique and aggressive tone under load, and the free-flowing design amplifies engine induction sounds. Check out the video to hear the tone. The stock intake duct is utilized to provide cool airflow to the high-flow Mishimoto oiled air filter, which features increased filtration surface area compared to the stock paper filter. This filter can be cleaned and reused, providing a lifetime of service. The intake includes a steel heatshield with pre-assembled rubber trim to keep hot engine air out and help draw cold outside air into the filter. This unit is a complete bolt-on that functions perfectly with the stock tune and can be installed in one hour using common hand tools. This performance air intake kit is also fully functional with our silicone intake hoses as well. This kit includes the Mishimoto Lifetime Warranty, ensuring superior product quality and craftsmanship." År 2003 grundades Mishimoto som idag är världens ledande företag inom prestanda kylningsprodukter till vardagsbilar, banbilar, pickuper, offroadbilar och motorcyklar!Deras sortiment består av bland annat aluminiumkylare, intercoolers, oljekylare, växellådskylare, termostater, luftfilterkit, silikonslangkit, oljelock, kylarlock och mycket mera, varav det mesta är framtaget för enkel och direkt passform, v...

2 985 kr
3 023 krinkl. frakt
L-M-R
Mishimoto BMW E46 M3 Prestanda Aluminiumkylare, 2001-2006

Mishimoto BMW E46 M3 Prestanda Aluminiumkylare, 2001-2006

Mishimoto BMW E46 M3 Prestanda Aluminiumkylare, 2001-2006Passar till: 2001-2006 BMW M3 3.2 Liter S6S420G 2001-2006 BMW M3 3.2 Liter S6S420G(SMG)Produktbeskrivning: The S54 is an incredible feat of engineering. Smooth power delivery, individual throttle bodies, and an 8,000 rpm redline makes for an unforgettable driving experience. As with any BMW, maintenance is key to extending the life of your vehicle and ensuring that you're getting a driving experience rivaled by very few other vehicles on the road. As many of these vehicles see frequent track time, the team at Mishimoto felt a need to develop a performance aluminum radiator that would not only provide improved durability, but also deliver the efficiency needed for track driving. Our team of engineers developed an extremely dense core that provides a greater number of coolant tubes and a very dense fin composition. This allows for more heat transfer contact points which results in greater heat exchange and improved efficiency. Additionally, this dense core provides a 32% increase in coolant surface area, a 15% increase in air surface area, and a 25% increase in coolant capacity. All of these factors will contribute to lower temperatures and greater heat rejection, ideal for those in warm climates and track use. This radiator is designed as a complete bolt-in fit, requiring no modification for fitment with the stock fan and shrouding. Our end tanks are constructed from high quality aluminum TIG-welded to a 100% brazed aluminum core. Not only does this aid in heat transfer, but it provides the reliability needed for years of service. This radiator is also applicable with most aftermarket supercharger kits, providing the cooling power needed for power levels above stock. As with all our products, the Mishimoto E46 M3 Performance Aluminum Radiator includes the Mishimoto Lifetime Warranty, ensuring superior product quality and craftsmanship. År 2003 grundades Mishimoto som idag är världens ledande företag inom pre...

7 897 kr
7 935 krinkl. frakt
L-M-R
Mishimoto BMW E90/E92 med N52 Motor Silikon Insugsslang, 2004-2012 Blå

Mishimoto BMW E90/E92 med N52 Motor Silikon Insugsslang, 2004-2012 Blå

Mishimoto BMW E90/E92 med N52 Motor Silikon Insugsslang, 2004-2012 BlåPassar till: 2006 BMW 325Ci Base 2.5 Liter 5HP-19 2006 BMW 325Ci Base 2.5 Liter S5D250G 2006 BMW 325i Base 3.0 Liter A6HP19Z 2006 BMW 325i Base 3.0 Liter S6-17BG 2006 BMW 325xi Base 3.0 Liter GA6HP19Z 2006 BMW 325xi Base 3.0 Liter GS6X37BZ 2007-2008 BMW 328i Base 3.0 Liter A6HP19Z 2007-2013 BMW 328i Base 3.0 Liter GA6-L45R 2011-2013 BMW 328i Base 3.0 Liter GA6HP19Z 2012-2013 BMW 328i Base 3.0 Liter GA8HP45Z 2007-2013 BMW 328i Base 3.0 Liter S6-17BG 2009-2010 BMW 328i xDrive Base 3.0 Liter A6HP19Z 2009-2013 BMW 328i xDrive Base 3.0 Liter GA6-L45R 2011-2013 BMW 328i xDrive Base 3.0 Liter GA6HP19Z 2013 BMW 328i xDrive Base 3.0 Liter GA8HP45Z 2009-2013 BMW 328i xDrive Base 3.0 Liter S6X37BZ 2007-2008 BMW 328xi Base 3.0 Liter A6HP19Z 2007-2008 BMW 328xi Base 3.0 Liter GA6-L45R 2007-2008 BMW 328xi Base 3.0 Liter S6X37BZ 2006 BMW 330i Base 3.0 Liter A6HP19Z 2006 BMW 330i Base 3.0 Liter S6-37BZ 2006 BMW 330xi Base 3.0 Liter GA6HP19Z 2006 BMW 330xi Base 3.0 Liter GS6X37BZProduktbeskrivning: The Mishimoto N52 silicone intake boot is constructed of five layers of silicone with steel reinforcement rings for maximum durability. The steel reinforcement rings keep this hose from collapsing when under load, keeping your engine supplied with adequate airflow. The stock N52 intake boot has a resonator that BMW included to keep the N52 quiet. We tossed that resonator to the curb for a nice increase in engine and intake tone. This N52 intake boot fits with the stock airbox and single stage or 3-stage intake manifolds. The silicone construction will provide you with a long service life, and the Mishimoto Lifetime Warranty will make sure your intake boot is always leak free!År 2003 grundades Mishimoto som idag är världens ledande företag inom prestanda kylningsprodukter till vardagsbilar, banbilar, pickuper, offroadbilar och motorcyklar!Deras sortiment består av bland annat aluminiumkylare, intercoolers, oljekylare,...

692 kr
730 krinkl. frakt
L-M-R
Mishimoto BMW E90/E92 med N52 Motor Silikon Insugsslang, 2004-2012 Röd

Mishimoto BMW E90/E92 med N52 Motor Silikon Insugsslang, 2004-2012 Röd

Mishimoto BMW E90/E92 med N52 Motor Silikon Insugsslang, 2004-2012 RödPassar till: 2006 BMW 325Ci Base 2.5 Liter 5HP-19 2006 BMW 325Ci Base 2.5 Liter S5D250G 2006 BMW 325i Base 3.0 Liter A6HP19Z 2006 BMW 325i Base 3.0 Liter S6-17BG 2006 BMW 325xi Base 3.0 Liter GA6HP19Z 2006 BMW 325xi Base 3.0 Liter GS6X37BZ 2007-2008 BMW 328i Base 3.0 Liter A6HP19Z 2007-2013 BMW 328i Base 3.0 Liter GA6-L45R 2011-2013 BMW 328i Base 3.0 Liter GA6HP19Z 2012-2013 BMW 328i Base 3.0 Liter GA8HP45Z 2007-2013 BMW 328i Base 3.0 Liter S6-17BG 2009-2010 BMW 328i xDrive Base 3.0 Liter A6HP19Z 2009-2013 BMW 328i xDrive Base 3.0 Liter GA6-L45R 2011-2013 BMW 328i xDrive Base 3.0 Liter GA6HP19Z 2013 BMW 328i xDrive Base 3.0 Liter GA8HP45Z 2009-2013 BMW 328i xDrive Base 3.0 Liter S6X37BZ 2007-2008 BMW 328xi Base 3.0 Liter A6HP19Z 2007-2008 BMW 328xi Base 3.0 Liter GA6-L45R 2007-2008 BMW 328xi Base 3.0 Liter S6X37BZ 2006 BMW 330i Base 3.0 Liter A6HP19Z 2006 BMW 330i Base 3.0 Liter S6-37BZ 2006 BMW 330xi Base 3.0 Liter GA6HP19Z 2006 BMW 330xi Base 3.0 Liter GS6X37BZProduktbeskrivning: The Mishimoto N52 silicone intake boot is constructed of five layers of silicone with steel reinforcement rings for maximum durability. The steel reinforcement rings keep this hose from collapsing when under load, keeping your engine supplied with adequate airflow. The stock N52 intake boot has a resonator that BMW included to keep the N52 quiet. We tossed that resonator to the curb for a nice increase in engine and intake tone. This N52 intake boot fits with the stock airbox and single stage or 3-stage intake manifolds. The silicone construction will provide you with a long service life, and the Mishimoto Lifetime Warranty will make sure your intake boot is always leak free!År 2003 grundades Mishimoto som idag är världens ledande företag inom prestanda kylningsprodukter till vardagsbilar, banbilar, pickuper, offroadbilar och motorcyklar!Deras sortiment består av bland annat aluminiumkylare, intercoolers, oljekylare,...

692 kr
730 krinkl. frakt
L-M-R
Mishimoto BMW E90/E92 med N52 Motor Silikon Insugsslang, 2004-2012 Svart

Mishimoto BMW E90/E92 med N52 Motor Silikon Insugsslang, 2004-2012 Svart

Mishimoto BMW E90/E92 med N52 Motor Silikon Insugsslang, 2004-2012 SvartPassar till: 2006 BMW 325Ci Base 2.5 Liter 5HP-19 2006 BMW 325Ci Base 2.5 Liter S5D250G 2006 BMW 325i Base 3.0 Liter A6HP19Z 2006 BMW 325i Base 3.0 Liter S6-17BG 2006 BMW 325xi Base 3.0 Liter GA6HP19Z 2006 BMW 325xi Base 3.0 Liter GS6X37BZ 2007-2008 BMW 328i Base 3.0 Liter A6HP19Z 2007-2013 BMW 328i Base 3.0 Liter GA6-L45R 2011-2013 BMW 328i Base 3.0 Liter GA6HP19Z 2012-2013 BMW 328i Base 3.0 Liter GA8HP45Z 2007-2013 BMW 328i Base 3.0 Liter S6-17BG 2009-2010 BMW 328i xDrive Base 3.0 Liter A6HP19Z 2009-2013 BMW 328i xDrive Base 3.0 Liter GA6-L45R 2011-2013 BMW 328i xDrive Base 3.0 Liter GA6HP19Z 2013 BMW 328i xDrive Base 3.0 Liter GA8HP45Z 2009-2013 BMW 328i xDrive Base 3.0 Liter S6X37BZ 2007-2008 BMW 328xi Base 3.0 Liter A6HP19Z 2007-2008 BMW 328xi Base 3.0 Liter GA6-L45R 2007-2008 BMW 328xi Base 3.0 Liter S6X37BZ 2006 BMW 330i Base 3.0 Liter A6HP19Z 2006 BMW 330i Base 3.0 Liter S6-37BZ 2006 BMW 330xi Base 3.0 Liter GA6HP19Z 2006 BMW 330xi Base 3.0 Liter GS6X37BZProduktbeskrivning: The Mishimoto N52 silicone intake boot is constructed of five layers of silicone with steel reinforcement rings for maximum durability. The steel reinforcement rings keep this hose from collapsing when under load, keeping your engine supplied with adequate airflow. The stock N52 intake boot has a resonator that BMW included to keep the N52 quiet. We tossed that resonator to the curb for a nice increase in engine and intake tone. This N52 intake boot fits with the stock airbox and single stage or 3-stage intake manifolds. The silicone construction will provide you with a long service life, and the Mishimoto Lifetime Warranty will make sure your intake boot is always leak free!År 2003 grundades Mishimoto som idag är världens ledande företag inom prestanda kylningsprodukter till vardagsbilar, banbilar, pickuper, offroadbilar och motorcyklar!Deras sortiment består av bland annat aluminiumkylare, intercoolers, oljekylar...

692 kr
730 krinkl. frakt
L-M-R
For BMW X5 E70 BMW X6 E71 E72 2006-2014 3712 6790078 Pair Rear Air Suspension Spring Bag

For BMW X5 E70 BMW X6 E71 E72 2006-2014 3712 6790078 Pair Rear Air Suspension Spring Bag

Application: For BMW X5 E70 2007–2013 For BMW X6 E71 2008–2012 For BMW X6 E72 2009–2014 Reference OE/OEM Number: 3712 6790 078 , 37126773664 , 37126774041 , 37126783419, 37126783420 , 37126790078 , 37126790079 , 37126790080 37126790081 , 37126790082 , 37126790083 Specification: -Condition:Brand New -Quantity:1 pair (for rear left and right side) -Warranty: 1 year warranty for any manufacture defect -Mates with OE Air Lines -Designed for Comfort Suspension - Mates with OE Air Lines- Designed for Comfort Suspension and high quality - Fast Shipping - Replaces the original spring, OE quality - Safe carrying capacity and stability - High-quality materials according to OE specifications, for high load capacity and long service life Note: These air suspension bags are aftermarket ones. They will replace the original rear air springs. Instruction is not included. Professional installation is recommended Contact us please for whatever we can help Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Goods shall be followed the return procedure and returned to the manufacturer for review, testing and examination, and the manufacturer will not arrange collection for the product. Based on the manufacturers' opinion, we will be afforded reasonable opportunity and facilities to investigate any claims made under the Warranty. The above warranty is given by us subject to you having no liability in respect of any defect arising from wear and tear, willful damage, negligence, tampering of the Goods, incorrect ...

458 kr

Frakt okänd

Maxpeedingrods
Autoaid ® TIEFENSCANNER OBD2 Code Reader for Motor ABS Airbag Air etc. SERVICE RESET for all brands such as BMW Mercedes Opel VW Audi Ford Volvo and much more in German

Autoaid ® TIEFENSCANNER OBD2 Code Reader for Motor ABS Airbag Air etc. SERVICE RESET for all brands such as BMW Mercedes Opel VW Audi Ford Volvo and much more in German

autoaid Starter This is of professional Werkstattqualität autoaid now available for all Autofahrer. autoaid because only when there is a sensational Diagnosetiefe and easy to operate at an unbeatable price; • read and erase DTCs in all control units • Servicerückstellung graphic displays and sensors • for all cars with OBD2 connector • all fault codes stored in German with over 90,000 database for manufacturer-specific codes • autoaid trouble free access to the Community with thousands of solutions in OBD 2 Controller Fehlerspeicher read and delete errors and postpone Service for all models with OBD 2 Connector Approx. 1999 until 2015 this manufacturer: Alfa Romeo, Citroen, Audi, BMW, Fiat / Dacia, Daihatsu / Ford / Honda / Hyundai / Kia / Lancia / Lexus, Mazda, Mercedes-Benz, Mini, Mitsubishi, Nissan, Opel, Peugeot, Renault, Seat, Skoda, Smart, Suzuki, Toyota, Volvo and VW. Made in Germany-developed and designed in the Berlin autoaid Diagnostic tools will be developed in Berlin by us and are only directly with US available only in this way, our product and to guarantee a high quality of service for all questions regarding the Installation, functions and Fahrzeugabdeckung we are to you by phone: 46 / 030 7777 50 System requirements: Suitable for all computers, Tablets and Laptops with Windows XP (ab, Internet connection for all buttons and Softwaredownload except OBD2. Box contents: autoaid Starter Diagnostic Interface and OBD2–with integrated USB cable and Software Download for Windows

1 194 kr

Frakt okänd

Amazon DE
iCarsoft BM II bmii Diagnostic Scanner For BMW Auto Car Diagnostic Code Scanner Trouble Code Read & Erase Airbag ODB2 Diagnostic Scanner Engine ABS Kombi Instrument and all other parts, Service Reset, Reset, DPF Diesel Pratikel Filter Reset Xxltech Reset

iCarsoft BM II bmii Diagnostic Scanner For BMW Auto Car Diagnostic Code Scanner Trouble Code Read & Erase Airbag ODB2 Diagnostic Scanner Engine ABS Kombi Instrument and all other parts, Service Reset, Reset, DPF Diesel Pratikel Filter Reset Xxltech Reset

The Debts Icarsoft Bmii is a professional diagnostic tool for BMW & MINI vehicles that highly functional to your first generation of scanners. Main Features: Oil/Service/Brake Service Reset function The Icarsoft 2 nd generation diagnostic tools, you can reset oil service and brake lights in one push of a button on supported vehicles. EPB Reset function Brake Pad/Shoe changes on vehicles with the EPB (Electronic Fesstellbremsen) must be fitted with a diag tool, in order to fully re calibrate – in a supported models carried out. SAS Reset function, can measure the angle of the steering wheel and turned through the speed, you. When the SAS needs to be changed, many of the so need the new sensor calibrated. You can carry on the steering angle Nacheichung models are supported. DPF Regeneration or replacement guide a be forced the regeneration of diesel particulate filter (DPF) on supported vehicles – this should be done by Geschultes staff. Features: – Diagnostic Trouble Codes (DTCs) reads and deletes on all OBDII Car. – Supports many other BMW/MINI only works, motor, automatic Trans ABS, airbag, air conditioner, instr cluster, EPB, OBD16 unable. Move & # X25CF Full ECU diagnostic – Easy to use with metal dome key – Read live data stream information – upgradable via USB or TF card – Multilingual support Compatibility: – Most BMW/MINI 1998 – 2013 – 1 2003 – 2015 – 2 2013 – 2015 – 3 1998 – 2015 – 4 2013 – 2015 – 5 1997 – 2015 – 6 2004 – 1995 – 2015 – Ich 2013 – 2015 – X 1998 of 7 2015 – 2015 – Z 1996 – 2015 – Full Function list available on request or can be used on our website (Large to be too) Contents: – Main unit – User Manual – Main cable – USB cable – TF card – Nylon Carry Case & # X25CF; TF card reader

1 632 kr

Frakt okänd

Amazon DE
For BMW M50 M52 M52TU M52B25 24V H-Beam Connecting Rods Conrods

For BMW M50 M52 M52TU M52B25 24V H-Beam Connecting Rods Conrods

Application: For BMW M50 M52 B25 TU 24V M52TUB25 For BMW E46 323i, 323Ci M52TUB25 1998 - 2000 For BMW E39 523i M52TUB25 1998 - 2000 For BMW E36/7 Z3 2.3i M52TUB25 1998 - 2000 Specification: - TÜV Certification Con Rods - Type: Forged 4340 aircraft chrome moly quality steel for racing - H-beam Conrods Quantity: 6 Pieces as showing in picture - Bolts: Including ARP 2000 bolts - Note: Extra cost for upgrading to ARP L19 bolts - Bolts Size: ARP 2000 3/8" bolts - Tolerance: Balanced to +/- 1 gram in set - Piston Bolt Hole: +-4/1000mm - Power: 600hp ~ 800PS per set - Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM - Top acceleration: 9000rpm - Warranty: 2 years warranty for any manufacturing defect Dimensions: Center to center length: 140mm Big end diameter: 48mm Small end diameter: 22mm Big end width: 21.9mm Small end width: 21.9mm Feature: - Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing - Designed and processed by CNC machine. - All big and small ends are finished with SUNNEN honing machine - Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk - 100% X-rayed, sonic tested and magnafluxed - Multi-stage heat treated - Shot peened to relieve stress - Come with the bronzed bushing suitable for the floating piston pin Note: - Professional installation is highly recommended (No Instruction Included) - Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. - Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with you...

3 754 kr

Frakt okänd

Maxpeedingrods
For BMW 325e E30 M20 M20B27 2.7L Connecting Rods H-Beam Conrods

For BMW 325e E30 M20 M20B27 2.7L Connecting Rods H-Beam Conrods

Application: For BMW 325e E30 M20 M20B27 2.7L Specification: - TÜV Certification Con Rods - Type: Forged 4340 aircraft chrome moly quality steel for racing - H-beam Conrods Quantity: 6 Pieces as showing in picture - Bolts: Including Genuine ARP 2000 bolts - Note: Extra cost for upgrading to ARP L19 bolts - Bolts Size: ARP 2000 3/8" bolts - Tolerance: Balanced to +/- 1 gram in set - Piston Bolt Hole: +-4/1000mm - Power: 600hp ~ 800PS per set - Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM - Top acceleration: 9000rpm - Warranty: 2 years warranty for any manufacturing defect Dimensions: Center to center length: 130mm Big end diameter: 48mm Small end diameter: 22mm Big end width: 22mm Small end width: 22mm Feature: - Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing - Designed and processed by CNC machine. - All big and small ends are finished with SUNNEN honing machine - Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk - 100% X-rayed, sonic tested and magnafluxed - Multi-stage heat treated - Shot peened to relieve stress - Come with the bronzed bushing suitable for the floating piston pin Note: - Professional installation is highly recommended (No Instruction Included) - Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. - Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including...

3 767 kr

Frakt okänd

Maxpeedingrods
For BMW S38 S38B35 S38B36 S38B38 e24 e34 e28 144mm ARP2000 Connecting Rod Rods

For BMW S38 S38B35 S38B36 S38B38 e24 e34 e28 144mm ARP2000 Connecting Rod Rods

Application: For BMW S38 B35 1988 M5 M6 For BMW S38: straight-6 DOHC piston engine S38B35  1986 - 1988 ,  for BMW E28 M5 (NA spec), for BMW E24 M6 (NA spec),;  for BMW E24 M635CSi with  catalytic converter S38B36 1989 - 1993  for BMW E34 M5 (NA spec) and Euro spec 1989–1992 S38B38 1992 - 1996  for BMW E34 M5 Feature: - Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing - Designed and processed by CNC machine. - All big and small ends are finished with SUNNEN honing machine - Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk - 100% X-rayed, sonic tested and magnafluxed - Multi-stage heat treated - Shot peened to relieve stress - Come with the bronzed bushing suitable for the floating piston pin Dimensions: Center to center length: 144mm Big end diameter: 52mm Small end diameter: 22mm Big end width: 23.9mm Small end width: 23.9mm Specification: - TÜV Certification Con Rods - Type: Forged 4340 aircraft chrome moly quality steel for racing - H-beam Conrods Quantity: 6 Pieces as showing in picture - Bolts: Including ARP 2000 bolts - Note: Extra cost for upgrading to ARP L19 bolts - Bolts Size: ARP 2000 3/8" bolts - Tolerance: Balanced to +/- 1 gram in set - Piston Bolt Hole: +-4/1000mm - Power: 600hp ~ 800PS per set - Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM - Top acceleration: 9000rpm - Warranty: 2 years warranty for any manufacturing defect Note: - Professional installation is highly recommended (No Instruction Included) - Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. - Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via ...

3 754 kr

Frakt okänd

Maxpeedingrods
For BMW 2002Ti/Tii Turbo M10 High Performance H-Beam Connecting Rods Conrods

For BMW 2002Ti/Tii Turbo M10 High Performance H-Beam Connecting Rods Conrods

Application: For BMW 2002 Ti / ii Turbo M10 135mm Forged Conrods Specification: TÜV Certification Con Rods Type: Forged 4340 aircraft chrome moly quality steel for racing H-beam Conrods Quantity: 4 Pieces a set Bolts: Including Genuine ARP 2000 bolts Note: Extra cost for upgrading to ARP L19 bolts Bolts Size: ARP 2000 3/8" bolts Tolerance: Balanced to +/- 1 gram in set Piston Bolt Hole: +-4/1000mm Power: 600hp ~ 800PS per set Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM Top acceleration: 9000rpm warranty: 2 years warranty for any manufacturing defect Dimensions: Center to center length: 135mm Big end diameter: 52mm Small end diameter: 22mm Big end width: 23.876mm Small end width: 23.88mm Feature: -Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing -Designed and processed by CNC machine. -All big and small ends are finished with SUNNEN honing machine -Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk -124% X-rayed, sonic tested and magnafluxed -Multi-stage heat treated -Shot peened to relieve stress -Come with the bronzed bushing suitable for the floating piston pin Note: Professional installation is highly recommended (No Instruction Included) Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault)...

2 429 kr

Frakt okänd

Maxpeedingrods
For BMW E34 M5 S38B38 3.8L H-Beam Connecting Rods High Performance Conrods

For BMW E34 M5 S38B38 3.8L H-Beam Connecting Rods High Performance Conrods

Application: For BMW E34 M5 S38B38 3.8L 1991 - 1995 Feature: - Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing - Designed and processed by CNC machine. - All big and small ends are finished with SUNNEN honing machine - Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk - 100% X-rayed, sonic tested and magnafluxed - Multi-stage heat treated - Shot peened to relieve stress - Come with the bronzed bushing suitable for the floating piston pin Dimensions: Center to center length: 142.5mm Big end diameter: 52mm Small end diameter: 22.02mm Big end width: 24mm Small end width: 24mm Specification: - TÜV Certification Con Rods - Type: Forged 4340 aircraft chrome moly quality steel for racing - H-beam Conrods Quantity: 6 Pieces as showing in picture - Bolts: Including Genuine ARP 2000 bolts - Note: Extra cost for upgrading to ARP L19 bolts - Bolts Size: ARP 2000 3/8" bolts - Tolerance: Balanced to +/- 1 gram in set - Piston Bolt Hole: +-4/1000mm - Power: 600hp ~ 800PS per set - Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM - Top acceleration: 9000rpm - Warranty: 2 years warranty for any manufacturing defect Note: - Professional installation is highly recommended (No Instruction Included) - Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. - Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form...

3 246 kr

Frakt okänd

Maxpeedingrods
For BMW S1000RR K46 top quality Conrods Connecting Rod rods with ARP bolts

For BMW S1000RR K46 top quality Conrods Connecting Rod rods with ARP bolts

Application: For BMW S1000RR / K46 999cc Feature: -Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing -Designed and processed by CNC machine. -All big and small ends are finished with SUNNEN honing machine -Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk -123% X-rayed, sonic tested and magnafluxed -Multi-stage heat treated -Shot peened to relieve stress -Come with the bronzed bushing suitable for the floating piston pin Dimensions: Center to center length: 103mm Big end diameter: 37mm Small end diameter: 17mm Press fit, no bushing with light weight 279g(without bolts) Specification: TÜV Certification Con Rods Type: Forged 4340 aircraft chrome moly quality steel for racing H-beam Conrods Quantity: 4 Pieces a set Bolts: Including ARP 2000 bolts Note: Extra cost for upgrading to ARP L19 bolts Bolts Size: Genuine ARP 2000 5/16" bolts Tolerance: Balanced to +/- 1 gram in set Piston Bolt Hole: +-4/1000mm Power: 600hp ~ 800PS per set Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM Top acceleration: 9000rpm warranty: 2 years warranty for any manufacturing defect Note: Professional installation is highly recommended (No Instruction Included) Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return ...

3 556 kr

Frakt okänd

Maxpeedingrods
For BMW X1 X3 X4 X5 Z4 E84 E89 F10 F11 11127588412 Cylinder Head Rocker Cover

For BMW X1 X3 X4 X5 Z4 E84 E89 F10 F11 11127588412 Cylinder Head Rocker Cover

Application: for BMW 1 Series F20 2011-2019 Hatchback 125i for BMW 1 Series F21 2011-2019 Hatchback 125i for BMW 2 Series F22, F87 2013-2019 Coupe 220i for BMW 2 Series F22 2014-2019 Coupe 228i for BMW 2 Series F23 2014-2019 Convertible 220i, 228i for BMW 3 Gran Turismo F34 2012-2016 Hatchback 320i, 320i xDrive, 328i, 328i xDrive for BMW 3 Series F30, F35, F80 2011-2016 Saloon 320i xDrive, 328i xDrive for BMW 3 Series F30, F80 2011-2018 Saloon 320i, 328i for BMW 3 Series F31 2012-2016 Estate 320i xDrive, 328i, 328i xDrive for BMW 4 Gran F36 2014-2019 Coupe 420i xDrive, 428i, 428i xDrive for BMW 4 Series F32, F82 2013-2019 Coupe 420i, 428i, 428i xDrive for BMW 4 Series F33, F83 2013-2019 Convertible 428i, 428i xDrive for BMW 5 Series F10 2010-2016 Saloon 520i, 528i, 528i xDrive for BMW 5 Series F11 2010-2019 Estate 520i, 528i, 528i xDrive for BMW X1 E84 2011-2015 Estate sDrive 20i, xDrive 20i, xDrive 28i for BMW X3 F25 2011-2017 SUV sDrive 20i, xDrive 20i, xDrive 28i for BMW X4 F26 2014-2018 SUV xDrive 20i, xDrive 28i for BMW X5 F15, F85 2015-2018 SUV xDrive 40e for BMW Z4 Roadster E89 2011-2019 Convertible sDrive 18i, sDrive 20i, sDrive 28i OEM Number or Interchangeable Part Number: 11127588412, 11 12 7 588 412, 11-12-7-588-412 Specification: Package Includes:1 piece as picture shown Condition: New Notice: - Please check the OEM Number before purchase. This is the best way to confirm the fitment. - Please fixated the opposite angles before install the screws, and screw down slowly after all the holes fixed. Don't screw down when just install one screw, otherwise the prodduct would be damaged, and this is not our responsibility. - 2 Years warranty for any manufacture defect. Please provide photos or videos to apply for warranty. -These Cylinder Head Cover are aftermarket ones. They will replace the original ones. If you purchase the wrong item according to your vehicle model instead of OEM number,we are not responsible for the After-Sales Service. - Instruction is...

1 177 kr

Frakt okänd

Maxpeedingrods
iCarsoft bmii BMW and Mini Smart Diagnostic Scanner Tool SRS ABS Brake Reset EBP SAS DPF

iCarsoft bmii BMW and Mini Smart Diagnostic Scanner Tool SRS ABS Brake Reset EBP SAS DPF

The Debts Icarsoft Bmii is a professional diagnostic tool for BMW & MINI vehicles that highly functional to your first generation of scanners. Main Features: Oil/Service/Brake Service Reset function The Icarsoft 2 nd generation diagnostic tools, you can reset oil service and brake lights in one push of a button on supported vehicles. EPB Reset function Brake Pad/Shoe changes on vehicles with the EPB (Electronic Fesstellbremsen) must be fitted with a diag tool, in order to fully re calibrate – in a supported models carried out. SAS Reset function Measures the angle of the steering wheel and speed, that will turn you. When the SAS needs to be changed, many of the so need the new sensor calibrated. You can carry on the steering angle Nacheichung models are supported. DPF Regeneration or replacement Gap A Be Forced the regeneration of diesel particulate filter (DPF) on supported vehicles – this should be done by Geschultes staff. Features: & # X25CF diagnostic trouble codes (DTCs) reads and deletes all OBDII Car. & # X25CF; Supports many other BMW/MINI only works, motor, automatic Trans ABS, airbag, air conditioner, instr cluster, EPB, OBD16 unable. Move & # X25CF Full ECU diagnostic & # X25CF, easy to use metal dome key & # X25CF and read Live Data Stream Information & # X25CF; Upgradeable via USB or TF card & # X25CF; Multilingual support Compatibility: & # X25CF – Most Of The BMW/MINI 1998 – 2013 & # X25CF; 1 2003 – 2015 & # X25CF, 2 2013 – 2015 & # X25CF; 3 1998 – 2015 & # X25CF; 4 2013 – 2015 & # X25CF; 5 1997 – 2015 & # X25CF, 6 2004 – 2015 & # X25CF; 7 1995 – 2015 & # X25CF; I 2013 – 2015 & # X25CF; x 1998 – 2015 & # X25CF; Z 1996 – 2015 & # X25CF, fully functional list available on request or can be used on our website (Large to be too) Box Contents: & # X25CF; Main unit & # X25CF instruction manual ( & # X25CF, main cable & # X25CF USB Cable; & # X25CF, support TF card & # X25CF nylon carrying bag & # X25CF, TF card reader

1 827 kr

Frakt okänd

Amazon DE
Rear Air Suspension Spring Bag & Air Compressor Pump 37206792855 for BMW 5 E61

Rear Air Suspension Spring Bag & Air Compressor Pump 37206792855 for BMW 5 E61

Application: for BMW 5 Series E61 2003-2010 Rear -Platform: E61 OEM & Part Number: 37126765602 , 37126765603 , 37 12 6 765 602 , 37 12 6 765 603 37106793778 , 37206792855 , 37 10 6 793 778 37.10-6 793 778 , 37206792855 , 37.20-6 792 855 37206792855 , 37106793778 , 37 20 6 792 855 Specification: -Condition:Brand New -Quantity: 2x Air Suspension Spring Bag + 1x Air Compressor Pump - Placement on Vehicle: Rear Right & Left -Warranty: 2 years warranty for any manufacturing defect Feature: * Mates with OE Air Lines * Designed for Comfort Suspension and high quality * Fast Shipping * Replaces the original spring, OE quality * Safe carrying capacity and stability * High-quality materials according to OE specifications, for high load capacity and long service life Note: *These air suspension bags are aftermarket ones. They will replace the original rear air springs. *Instruction is not included. Professional installation is recommended *Contact us please for whatever we can help Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Goods shall be followed the return procedure and returned to the manufacturer for review, testing and examination, and the manufacturer will not arrange collection for the product. Based on the manufacturers' opinion, we will be afforded reasonable opportunity and facilities to investigate any claims made under the Warranty. The above warranty is given by us subject to you having no liability in respect of any defect arising from wear and tear, willful damage, negligence, tamper...

2 243 kr

Frakt okänd

Maxpeedingrods
H Beam 4340 Connecting Rods Conrods Con Rod For BMW B38A15M0 1.5T 3 cylinder

H Beam 4340 Connecting Rods Conrods Con Rod For BMW B38A15M0 1.5T 3 cylinder

Application: for BMW B38A15M0 1.5T 3 cylinder Specification: TÜV Certification Con Rods Type: Forged 4340 aircraft chrome moly quality steel for racing H-beam Conrods Quantity: 8 Pieces a set Bolts: Including Genuine 3/8" ARP 2000 bolts Note: Extra cost for upgrading to ARP L19 bolts Bolts Size: 3/8" Tolerance: Balanced to +/- 1 gram in set Piston Bolt Hole: +-4/1000mm Power: 600hp ~ 800PS per set Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM Top acceleration: 9000rpm Warranty: 1 year warranty for any manufacture defect Dimensions: Center to center length: 148.2mm Big end diameter: 48.6mm Small end diameter: 22mm Big end width: XX Small end width: XX Feature: -Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing -Designed and processed by CNC machine. All big and small ends are finished with SUNNEN honing machine -Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk -100% X-rayed, sonic tested and magnafluxed -Multi-stage heat treated -Shot peened to relieve stress -Come with the bronzed bushing suitable for the floating piston pin Note: Professional installation is highly recommended (No Instruction Included) Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Goods...

1 475 kr

Frakt okänd

Maxpeedingrods
For BMW M60 M60B40 4.0L M62 4.4L Conrods Con Rod Connecting Rod Rods 143mm

For BMW M60 M60B40 4.0L M62 4.4L Conrods Con Rod Connecting Rod Rods 143mm

Application: for BMW M60 M60B40 4.0L M62 4.4L Specification: TÜV Certification Con Rods Type: Forged 4340 aircraft chrome moly quality steel for racing H-beam Conrods Quantity: 8 Pieces a set Bolts: Including Genuine ARP 2000 bolts Note: Extra cost for upgrading to ARP L19 bolts Bolts Size: 3/8" Tolerance: Balanced to +/- 1 gram in set Piston Bolt Hole: +-4/1000mm Power: 600hp ~ 800PS per set Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM Top acceleration: 9000rpm warranty: 2 years warranty for any manufacturing defect Dimensions: Center to center length: 143mm Big end diameter: 52mm Small end diameter: 22mm Big end width: XX Small end width: XX Feature: - Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing - Designed and processed by CNC machine. - All big and small ends are finished with SUNNEN honing machine - Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk - 100% X-rayed, sonic tested and magnafluxed - Multi-stage heat treated - Shot peened to relieve stress - Come with the bronzed bushing suitable for the floating piston pin Note: Professional installation is highly recommended (No Instruction Included) Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Go...

5 316 kr

Frakt okänd

Maxpeedingrods
For BMW E30 M3 S14 2.3-2.5L I4 H-Beam Connecting Rods Performance Conrods

For BMW E30 M3 S14 2.3-2.5L I4 H-Beam Connecting Rods Performance Conrods

Application: For BMW E30 M3 S14B23 1988 - 1991 L4 Specification: - TÜV Certification Con Rods - Type: Forged 4340 aircraft chrome moly quality steel for racing - H-beam Conrods Quantity: 1 set of 4 pieces - Bolts: Including Genuine ARP 2000 bolts - Note: Extra cost for upgrading to ARP L19 bolts - Bolts Size: 3/8" ARP 2000 bolts - Tolerance: Balanced to +/- 1 gram in set - Piston Bolt Hole: +-4/1000mm - Power: 600hp ~ 800PS per set - Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM - Top acceleration: 9000rpm - Warranty: 2 years Dimensions: Center to center length: 144mm Big end diameter: 52mm Small end diameter: 22mm Big end width: 24mm Small end width: 24mm Feature: - Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing - Designed and processed by CNC machine. - All big and small ends are finished with SUNNEN honing machine - Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk - 100% X-rayed, sonic tested and magnafluxed - Multi-stage heat treated - Shot peened to relieve stress - Come with the bronzed bushing suitable for the floating piston pin Note: - Professional installation is highly recommended (No Instruction Included) - Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. - Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Go...

2 416 kr

Frakt okänd

Maxpeedingrods
For BMW 5 series F07 GT F11 GT 37106781827 Pair Rear Air Suspension Spring Bag

For BMW 5 series F07 GT F11 GT 37106781827 Pair Rear Air Suspension Spring Bag

Application: For BMW F07 GT F10 F11 for BMW 5S F10 Saloon for BMW 5S Gran Turismo F07 520d, 530dX, 530d, 535dX for BMW 5S Gran Turismo F07 535d, 535i, 535iX, 550iX, 550i for BMW 5S Touring Wagon F11 520d, 520i, 523i, 525d, 528i for BMW 5S Touring Wagon F11 530d, 530i, 535d, 535i, 550i Reference OE/OEM Number: 37106781827 / 37106781828 / 37106781843 / 37106781844 / 37106784378 / 37106784379 / 37106784380 / 37106784381 37 10 6 781 827 / 37 10 6 781 828 / 37 10 6 781 843 /37 10 6 781 844 / 37 10 6 784 378 / 37 10 6 784 379 / 37 10 6 784 380 / 37 10 6 784 381 -5 GT (F07) Features : - 2 years warranty for any manufacturing defect - Mates with OE Air Lines - Replaces the original spring, OE quality - Designed for Comfort Suspension - 2 pieces (for rear left and right side) - Brand New - High-quality materials according to OE specifications, for high load capacity and long service life Notice: - Please double check The OEM Numbers before making the payment. - These air suspension bags are aftermarket ones. They will replace the original rear air springs. - Instruction is not included. Professional installation is recommended - Contact us please for whatever we can help Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Goods shall be followed the return procedure and returned to the manufacturer for review, testing and examination, and the manufacturer will not arrange collection for the product. Based on the manufacturers' opinion, we will be afforded reasonable opportunity and facilities to investiga...

533 kr

Frakt okänd

Maxpeedingrods
2pcs for BMW 5S E60 E61 2003 - 2010 Rear Air Suspension Air Spring Bag 37126765602 New

2pcs for BMW 5S E60 E61 2003 - 2010 Rear Air Suspension Air Spring Bag 37126765602 New

Fit for: For BMW 5 Series 2003 - 2010 For BMW 5 E61 2003 - 2010 For BMW 5 Series E60 2001 - 2010 For BMW 520d 520i 523i For BMW 525d 525i 525xd 525xi For BMW 530d 530i 530xd 530xi For BMW 535d 545i 550i M5 Platform:Â E61,E60 Specification: * Reference OE/OEM Number: 37126765602, 37126765603, 37 12 6 765 602, 37 12 6 765 603 * Condition: Brand New * Quantity: 1 pair * Placement on Vehicle: Rear Right & Left * Warranty: 2 Years Warranty * Mates with OE Air Lines * Designed for Comfort Suspension and high quality * Replaces the original spring, OE quality * Safe carrying capacity and stability * High-quality materials according to OE specifications, for high load capacity and long service life Note: - These air suspension bags are aftermarket ones. They will replace the original rear air springs. - Instruction is not included. Professional installation is recommended - Contact us please for whatever we can help Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Goods shall be followed the return procedure and returned to the manufacturer for review, testing and examination, and the manufacturer will not arrange collection for the product. Based on the manufacturers' opinion, we will be afforded reasonable opportunity and facilities to investigate any claims made under the Warranty. The above warranty is given by us subject to you having no liability in respect of any defect arising from wear and tear, willful damage, negligence, tampering of the Goods, incorrect fitting of the Goods by you and/or a...

483 kr

Frakt okänd

Maxpeedingrods
For BMW 5 Series E39 Touring Rear Right Air Ride Suspension Spring Bag Bellows

For BMW 5 Series E39 Touring Rear Right Air Ride Suspension Spring Bag Bellows

Applications: For BMW 5 Series E39 1996 - 2003 Reference OE/OEM Number: 37121094614, 37121095082 Important Notice: - Condition:Â Brand New -Â Placement on Vehicle: Rear Right - Quantity:Â 1 piece, as picture show - 2 Years Warranty - Mates with OE Air Lines - Designed for Comfort Suspension and high quality - Fast Shipping - Replaces the original spring, OE quality - Safe carrying capacity and stability - High-quality materials according to OE specifications, for high load capacity and long service life Note: * Professional installation is highly recommended (No Instruction Included) * For any needs please contact us Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Goods shall be followed the return procedure and returned to the manufacturer for review, testing and examination, and the manufacturer will not arrange collection for the product. Based on the manufacturers' opinion, we will be afforded reasonable opportunity and facilities to investigate any claims made under the Warranty. The above warranty is given by us subject to you having no liability in respect of any defect arising from wear and tear, willful damage, negligence, tampering of the Goods, incorrect fitting of the Goods by you and/or a third party, abnormal working conditions, failure to follow our and/or the Goods' manufacturers' instructions (whether oral or in writing), misuse or alteration or repair of the Goods without our approval.

211 kr

Frakt okänd

Maxpeedingrods
For BMW 5 Series E39 Touring Rear Left Air Suspension Spring Bag RPF 9525

For BMW 5 Series E39 Touring Rear Left Air Suspension Spring Bag RPF 9525

Applications: For BMW 5 Series E39 1996 - 2003 Rear Left Air Suspension Bag Reference OE/OEM Number: 37121094613; 37121095081 Specification: - Condition:Â Brand New - Placement on Vehicle:Â rear left side - Quantity:Â 1 piece - 2 Years Warranty for any manufacturing defect - Mates with OE Air Lines - Designed for Comfort Suspension and high quality - Fast Shipping - Replaces the original spring, OE quality - Safe carrying capacity and stability - High-quality materials according to OE specifications, for high load capacity and long service life Note: - Professional installation is highly recommended (No Instruction Included) - For any needs please contact us Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Goods shall be followed the return procedure and returned to the manufacturer for review, testing and examination, and the manufacturer will not arrange collection for the product. Based on the manufacturers' opinion, we will be afforded reasonable opportunity and facilities to investigate any claims made under the Warranty. The above warranty is given by us subject to you having no liability in respect of any defect arising from wear and tear, willful damage, negligence, tampering of the Goods, incorrect fitting of the Goods by you and/or a third party, abnormal working conditions, failure to follow our and/or the Goods' manufacturers' instructions (whether oral or in writing), misuse or alteration or repair of the Goods without our approval.

223 kr

Frakt okänd

Maxpeedingrods
Lower Camber Control Arms for BMW E36 318 323 325 328 M3 Rear Adjustable CAC

Lower Camber Control Arms for BMW E36 318 323 325 328 M3 Rear Adjustable CAC

Application: For BMW E36 3 Series 316 318 323 325 328 E46 Adjustable Rear Lower Camber Control Arm ( E36 models; 3-series 92-98 (318i, 318is, 318ic, 323i, 323ic, 323is, 325i, 325is, 325ic, 328i, 328is, 328ic, M3) E46 models; 3-series 99-05 (323i, 323ci, 323cic, 325i, 325ci, 325cic, 325xi, 328i, 328ci, 328cic, 330i, 330ci, 330cic, 330xi, M3) E83 Models: X3 – 2.5i, 2.5si, 3.0i, 3.0si through 2010 E85 & E86 Models: Z4 – 2.5i, 2.5si, 3.0i, 3.0si, M-Coupe, M-Roadster E89 Models: Z4 – 3oi, 35i, 35is 09-curren) Specifications: Quantity: 1 pair of 2 bars as shown Color: Black Type: Suspensions Parts Features: - 100% brand new in box - Made by high strength aluminum and durable Powder-Coated Finish - Improved suspension geometry to reduce bump steer - Improves Rear Suspension, Handling, Predictable Response and even Prevents Premature Tire Wearing. - Design for Street, Track or Drift Racing Precise Adjustments with Long Service Life - Perfect for track cars, drift control, street course, off road - Direct bolt-on for OE factory or replacement - Professional Installer is Highly Recommended (No Instruction Included) - Alignment Highly Recommended After Install Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Goods shall be followed the return procedure and returned to the manufacturer for review, testing and examination, and the manufacturer will not arrange collection for the product. Based on the manufacturers' opinion, we will be afforded reasonable opportunity and facilities to investigate any ...

595 kr

Frakt okänd

Maxpeedingrods
H Beam 4340 EN24 Racing Connecting Rods Conrods Con Rod For BMW B48 2.0T 4pcs

H Beam 4340 EN24 Racing Connecting Rods Conrods Con Rod For BMW B48 2.0T 4pcs

Application: for BMW B48 2.0T DOHC Specification: TÜV Certification Con Rods Type: Forged 4340 aircraft chrome moly quality steel for racing H-beam Conrods Quantity: 4 Pieces a set Bolts: Including Genuine ARP 2000 3/8" bolts Note: Extra cost for upgrading to ARP L19 bolts Bolts Size: 3/8" Tolerance: Balanced to +/- 1 gram in set Piston Bolt Hole: +-4/1000mm Power: 600hp ~ 800PS per set Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM Top acceleration: 9000rpm warranty: 1 year warranty for any manufacture defect Dimensions: Center to center length: XX Big end diameter: XX Small end diameter: XX Big end width: XX Small end width: XX Feature: - Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing - Designed and processed by CNC machine. - All big and small ends are finished with SUNNEN honing machine - Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk - 100% X-rayed, sonic tested and magnafluxed - Multi-stage heat treated - Shot peened to relieve stress - Come with the bronzed bushing suitable for the floating piston pin Note: Professional installation is highly recommended (No Instruction Included) Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a warranty claim form (including a description of the fault) and return such Goods to us. Such Goods shall be fol...

1 871 kr

Frakt okänd

Maxpeedingrods
3.2L H-Beam For BMW E36 M3 325i 325s 328i M20 M52TU 3.2L Connecting Rods Conrods

3.2L H-Beam For BMW E36 M3 325i 325s 328i M20 M52TU 3.2L Connecting Rods Conrods

Application: For BMW M3 325i 325s 328i M20M52TU M52B28 3.2L For BMW 3 5 7 Series Z3 E36 328i 728i X M52B28 2.8 Specification: TÜV Certification Con Rods Type: Forged 4340 aircraft chrome moly quality steel for racing H-beam Conrods Quantity: 6 Pieces as showing in picture Bolts: Including ARP 2000 bolts Note: Extra cost for upgrading to ARP L19 bolts Bolts Size: ARP 2000 3/8" bolts Tolerance: Balanced to +/- 1 gram in set Piston Bolt Hole: +-4/1000mm Power: 600hp ~ 800PS per set Strength of the fastening (PSI): 220,000/230,000 PSI Torque: 48ft ≈ 65 NM Top acceleration: 9000rpm warranty: 2 years warranty for any manufacturing defect Dimensions: Center to center length: 135mm Big end diameter: 48mm Small end diameter: 22mm Big end width: 22mm Small end width: 22mm Feature: - Forged SAE 4340 Chrome Moly Steel for the highest strength and durability, dedicated for Racing - Designed and processed by CNC machine. - All big and small ends are finished with SUNNEN honing machine - Precision alignment sleeves positively locate the rod cap, maintaining big end bore size and eliminating cap walk - 100% X-rayed, sonic tested and magnafluxed - Multi-stage heat treated - Shot peened to relieve stress - Come with the bronzed bushing suitable for the floating piston pin Note: Professional installation is highly recommended (No Instruction Included) Custom Service: If there's no conrods you need on our site, we would be happy to help determine your requirements and develop a solution with you to satisfy your needs. Learn more about CUSTOM SERVICE Warranty Details: All Maxpeedingrods products have warranty and the warranty is subjected to different item (unless otherwise stated). If you have a problem with our product, please contact us via Email first. Full details of warranty are as follows: If Goods become faulty during the period of the warranty for reasons unconnected with your acts, omissions or misuse of the Goods, you must notify us in writing and/or by completing a war...

3 693 kr

Frakt okänd

Maxpeedingrods
Logga in

Bli medlem gratis